LER é VIAJAR, APRENDER, ADQUIRIR CULTURA, É TORNAR-SE GENTE.

Sejam bem vindos!

Para ter o texto Offline em formato txt, solicite-o via e-mail.

Caso se interesse pelos anúncios click nos mesmos para conhecê-los melhor e assim ajude o blogg Cego Lendo Livro.

Postagens super interessantes

Deixe seu email:

terça-feira, 14 de junho de 2011

Mundo perdido (Dinossauros - já foi filme)

MUNDO PERDIDO
Michael Crichton

Um livro de ficção, mas que nos dá grandes idéias de como eram os
dinossauros, ou seja, a história do livro é ficção, mas desenvolvida com
pesquisas reais. Ou seja, podemos aprender muito.

Orelha do Livro

MUNDO PERDIDO

O final do século XX testemunhou um notável aumento do interesse científico pelo tema da extinção das espécies. E é na esteira desse debate que Michael Crichton
lança seu Mundo perdido.
Ian Malcolm, um matemático iconoclasta, juntamente com uma equipe de pesquisadores, curiosamente heterogênea e munida de sofisticado equipamento, resolvem
voltar ao Parque dos Dinossauros numa ilha da Costa Rica. O mistério da extinção dos dinossauros, ocorrida há sessenta e cinco milhões de anos, ainda está insolúvel.
Qual a causa do seu desaparecimento? Desvendar esse mistério permitirá saber se os seres humanos também estariam fadados à extinção.
Com uma narrativa dinâmica e surpreendente, Michael Crichton nos conduz ao seu Mundo perdido, um mundo de terror onde o tempo parou e a luta pela sobrevivência
é a única resposta possível.

"O que realmente me interessa é saber se Deus teve alguma escolha na criação do mundo."
ALBERT EINSTEIN


"No interior do regime caótico, pequenas mudanças na estrutura quase sempre provocam enormes mudanças no comportamento. O comportamento complexo e controlável
é aparentemente impossível. "
STUART KAUFFMAN

"As seqüelas são inerentemente imprevisíveis."
IAN MALCOLM

INTRODUÇÃO

"Extinção na Fronteira K-T"


O final do século XX testemunhou um notável aumento do interesse científico pelo tema da extinção das espécies.
Na realidade, não é um tema novo - o barão Georges Cuvier, em 1786, pouco depois da Revolução Americana, demonstrou que muitas espécies haviam sido extintas.
Sendo assim, o fato da extinção das espécies já era aceito pelos cientistas quase três quartos de século antes de Darwin criar a teoria da evolução. E, depois de
Darwin, as várias controvérsias a respeito da teoria nem sempre diziam respeito à extinção.
Ao contrário, a extinção era considerada, de um modo geral, tão sem importância como um carro sem gasolina. A extinção das espécies era simplesmente uma prova
da incapacidade de adaptação. Os vários modos dessa adaptação foram intensamente estudados e ardorosamente debatidos. Porém, o fato de que algumas espécies falhavam
nesse processo não era considerado importante. O que se podia dizer a respeito? Entretanto, no começo da década de 1970, dois fatos contribuíram para enfocar o tema
da extinção sob uma nova ótica.
O primeiro foi o reconhecimento de que o seres humanos eram agora muito numerosos e estavam rapidamente alterando o planeta - eliminando habitats tradicionais,
desmatando as florestas tropicais, poluindo o ar e a água, talvez até mesmo modificando o clima global. No processo, muitas espécies animais estavam sendo extintas.
Alguns cientistas deram o alarme. O silêncio de outros era preocupante. Até que ponto ia a fragilidade do ecossistema da Terra? O comportamento da espécie humana
a levaria finalmente à própria extinção?
Ninguém tinha certeza. Uma vez que ninguém se dera ao trabalho de estudar a extinção de modo organizado, poucas eram as informações sobre os índices de extinção
em outras eras geológicas. Então os cientistas começaram a estudar a extinção no passado, esperando encontrar respostas para a ansiedade com o presente.
O segundo fato diz respeito a novos conhecimentos sobre a morte dos dinossauros. Há muito era sabido que todas as espécies de dinossauros foram extintas num
tempo relativamente curto, no fim do período Cretáceo, aproximadamente sessenta e cinco milhões de anos atrás. O modo pelo qual ocorreu essa extinção foi, durante
longo tempo, motivo de calorosos debates. Alguns paleontólogos acreditavam que fora catastroficamente rápido, outros achavam que a morte dos dinossauros fora mais
gradual, processando-se num período de dez mil a dez milhões de anos - sem dúvida, nem um pouco rápido.
Então, em 1980, o físico Luis Alvarez e três colaboradores descobriram concentrações do elemento irídio em rochas do fim do Cretáceo e começo da era terciária
- a chamada fronteira K-T ( foi estabelecido que o Cretáceo seria indicado pela letra K para não confundir com o Cambriano e outros períodos geológicos). O irídio
é raro na Terra, mas abundante em meteoros. A equipe de Alvarez argumentou que a presença de grande quantidade de irídio nas rochas da fronteira K-T sugeria que
um meteorito gigante, com muitos quilômetros de diâmetro, havia colidido com a Terra naquela época. Sua teoria era de que a poeira e fragmentos de rochas que haviam
escurecido o céu inibiram a fotossíntese, matando plantas e animais e terminando com o reino dos dinossauros.
Esta teoria dramática capturou a imaginação da mídia e do público e deu início a uma controvérsia que durou muitos anos. Onde estava a cratera do meteoro?
Vários locais foram propostos. No passado houve cinco períodos principais de extinção - teriam sido todos causados por meteoros? Haveria um ciclo de catástrofe de
vinte e seis milhões de anos? O planeta estaria agora à espera de outro impacto devastador?

Durante mais de uma década essas perguntas continuaram sem resposta. O debate seguiu cada vez mais intenso - até agosto de 1993, quando, num seminário semanal
do Instituto Santa Fé, um matemático iconoclasta chamado Ian Malcolm anunciou que nenhuma dessas questões era importante e que o debate sobre o impacto de meteoro
era " uma especulação frívola e irrelevante" .

- Considerem os números - disse Malcolm, inclinando-se no pódio, olhando diretamente para os seus ouvintes. - No nosso planeta existem atualmente cinqüenta
milhões de espécies de plantas e animais. Achamos que é uma diversidade notável; contudo, não é nada comparado ao que existia antes. Estima-se que tenha havido cinqüenta
bilhões de espécies neste planeta desde o começo da vida. Isso significa que para cada mil espécies que já existiram no planeta apenas uma permanece hoje. Desse
modo, 99,9 por cento de todas as espécies que já viveram estão extintas. E a matança em massa é responsável apenas por cinco por cento desse total. A espantosa maioria
das espécies morreu uma de cada vez.
"A verdade", disse Malcolm, "é que a vida na Terra tem sido marcada por um índice contínuo e regular de extinção. De um modo geral, a duração média da vida
de uma espécie era de quatro milhões de anos. Para os mamíferos era de um milhão de anos. Então as espécies desapareciam. Desse modo o verdadeiro padrão consistia
no aparecimento de uma espécie, seu crescimento e sua morte num período de alguns milhões de anos. Podemos afirmar que a média da extinção foi de uma espécie por
dia durante toda a história da vida no planeta.
"Mas por quê?", perguntou ele. "O que leva ao crescimento e declínio das espécies da Terra num ciclo de quatro milhões de anos?
"Uma resposta é que nós não fazemos idéia da intensa atividade do nosso planeta. Somente nos últimos cinqüenta mil anos - um piscar de olhos em geologia -
as florestas tropicais foram drasticamente reduzidas; depois voltaram a expandir. As florestas tropicais não são uma característica extremamente antiga do nosso
planeta. Na verdade, são relativamente novas. Há apenas dez mil anos, quando havia caçadores humanos no continente americano, uma camada de gelo estendia-se quase
até onde hoje é a cidade de Nova York. Muitos animais foram extintos nessa época.
"Assim, a maior parte da história da Terra mostra animais vivendo e morrendo num cenário extremamente ativo. Isso talvez explique 90 por cento das extinções.
Se os oceanos secarem ou ficarem mais salgados, então é claro que o plâncton morrerá. Porém, animais complexos como os dinossauros insularam-se - literal e figuradamente
- contra essas mudanças. Por que os animais complexos desaparecem? Por que não se ajustam? Fisicamente, parecem capazes de sobreviver. Não há nenhuma razão aparente
para sua extinção. Contudo, eles desaparecem.
"O que eu quero propor é que os animais complexos são extintos não devido a uma mudança na sua capacidade física de adaptação ao meio ambiente, mas por causa
do seu comportamento. Minha suposição é que a moderna teoria do caos, ou dinâmica não-linear, nos dá pistas muito interessantes de como isso acontece.
"Essa teoria afirma que o comportamento dos animais complexos pode mudar com grande rapidez e nem sempre para melhor. Afirma que o comportamento pode deixar
de responder ao meio ambiente, levando ao declínio e à morte. Afirma que os animais podem parar de se adaptar. Foi isso o que aconteceu com os dinossauros? É essa
a verdadeira causa do seu desaparecimento? Talvez jamais saibamos. Mas não é por acaso que os seres humanos estão tão interessados na extinção dos dinossauros. O
declínio dos dinossauros permitiu o desenvolvimento e crescimento dos mamíferos - incluindo nós. E isso nos leva a indagar se o desaparecimento dos dinossauros vai
se repetir, mais cedo ou mais tarde, com a espécie humana. Em nível mais profundo, a falha não estaria no destino - um meteoro caído do céu - mas no nosso comportamento.
No momento não temos resposta."
Depois ele sorriu.
- Mas eu tenho algumas suposições - ele disse.

PRÓLOGO

"A vida no limite do caos"


O Instituto Santa Fé foi instalado numa série de prédios da Canyon Road, onde antes era um convento e os seminários do instituto realizavam-se na sala onde
era antes a capela. De pé no pódio, iluminado por um raio de sol, Ian Malcolm fez uma pausa dramática, antes de continuar a palestra.
Malcolm tinha quarenta anos e era uma figura familiar no instituto. Foi um dos pioneiros da teoria do caos, mas teve sua carreira promissora prejudicada por
um grave acidente durante uma viagem à Costa Rica. Na ocasião, Malcolm foi dado como morto em vários noticiários. Mais tarde, ele diria: "Eu senti muito por ter
interrompido as comemorações em vários departamentos de matemática em todo o país, mas acontece que eu estava apenas levemente morto. Os cirurgiões fizeram maravilhas,
como certamente serão os primeiros a afirmar. Assim, estou de volta - na minha iteração seguinte, podemos dizer."
Vestido completamente de preto, apoiando-se numa bengala, Malcolm era a imagem da severidade. No instituto era conhecido por sua análise inconvencional e
sua tendência para o pessimismo. Sua palestra em agosto, intitulada "A vida no limite do caos", era típica do seu pensamento. Nela, Malcolm apresentou sua análise
da teoria do caos aplicada à evolução.
Não podia ter exigido um grupo de ouvintes mais bem-informado. O Instituto Santa Fé foi criado em meados da década de 1980 por um grupo de cientistas interessados
nas implicações da teoria do caos. Pertenciam a vários campos da ciência - física, economia, biologia, informática. O que tinham em comum era a crença de que a complexidade
do mundo, escondida sob uma ordem que até então havia se esquivado à definição da ciência, seria revelada pela teoria do caos, agora conhecida como a teoria da complexidade.
Segundo um cientista, a teoria da complexidade era "a ciência do século XXI".
O instituto havia estudado o comportamento de uma grande variedade de sistemas complexos - empresas no mercado, neurônios no cérebro humano, cascatas de enzimas
no interior de uma única célula, o comportamento grupai de pássaros migratórios -, sistemas tão complexos que não podiam ser estudados antes do advento do computador.
Era uma pesquisa nova e os resultados foram surpreendentes.
Não demorou para que os cientistas começassem a notar que os sistemas complexos apresentavam certos comportamentos em comum. Começaram a considerar esses
comportamentos como característicos de todos os sistemas complexos. Compreenderam também que esses comportamentos não podiam ser explicados por meio da análise dos
componentes dos sistemas. A abordagem científica tradicional do reducionismo - desmontar o relógio para ver como funciona - não levava a lugar algum nos sistemas
complexos, porque o comportamento interessante parecia ter origem na interação espontânea dos componentes. O comportamento não era planejado nem dirigido, apenas
acontecia. Esse comportamento foi por isso chamado de "auto-organizado".
Entre os comportamentos auto-organizados - disse Ian Malcolm -, dois são de especial interesse para o estudo da evolução. Um é a adaptação.
Nós a vemos por toda a parte. As grandes empresas se adaptam ao mercado, as células do cérebro adaptam-se para sinalizar o tráfego, o sistema imunológico
se adapta à infecção, os animais se adaptam ao alimento que lhes é oferecido. Chegamos a pensar que a capacidade de adaptação é característica dos sistemas
complexos - e pode ser uma das razões pelas quais a evolução parece levar a organismos mais complexos.
Ele mudou de posição, transferindo o peso do corpo para a bengala.
- Contudo, o mais importante - prosseguiu - é o modo pelo qual os sistemas complexos parecem conseguir um equilíbrio entre a necessidade de ordem e o imperativo
da mudança. Os sistemas complexos tendem a se posicionar num local a que chamamos de "o limite do caos". Imaginamos o limite do caos como um lugar onde há inovação
suficiente para manter vibrante um sistema vivo, e bastante mobilidade para evitar que passe para a anarquia. É uma zona de conflito e de alterações importantes,
onde o velho e o novo estão em luta constante. Encontrar o ponto de equilíbrio deve ser um processo bastante delicado - se um sistema vivo deriva para muito perto,
arrisca-se a cair na incoerência e na dissolução, mas, se o sistema se afasta demais do limite, torna-se rígido, congelado, totalitário. As duas condições levam
à extinção. Tanto o excesso quanto a escassez de mudança são destrutivos. Só no limite do caos os sistemas complexos podem se desenvolver. Fez uma pausa.
- E, por implicação, a extinção é o resultado inevitável de uma ou outra dessas estratégias - muitas ou poucas mudanças.
Os ouvintes balançavam a cabeça, concordando. Era um pensamento familiar para a maioria dos pesquisadores presentes. Na verdade, o conceito de limite do caos
era praticamente um dogma no Instituto Santa Fé.
- Infelizmente - continuou Malcolm - a lacuna entre esta síntese teórica e o fato da extinção é bastante extensa. Não temos meio de verificar se nosso pensamento
está correto. Os registros fósseis podem nos dizer que um animal foi extinto numa determinada época, mas não por quê. As simulações no computador têm valor limitado.
Também não podemos realizar pesquisas em organismos vivos. Sendo assim, somos obrigados a admitir que a extinção - não-verificável por meio de testes e não se prestando
a experiências - talvez não seja de modo algum uma matéria científica. Isso pode explicar por que o assunto tem sido alvo da mais intensa controvérsia religiosa
e política. Quero lembrar que não há nenhum debate religioso sobre o número de Avogadro, ou a constante de Planck, ou sobre as funções do pâncreas. Mas, quando se
trata de extinção, a controvérsia continua há duzentos anos. E me pergunto como será resolvida se... Sim? O que é?
No fundo da sala alguém ergueu a mão, acenando com impaciência. Malcolm franziu a testa, visivelmente aborrecido.

Era tradição do instituto que as perguntas só fossem feitas no fim da apresentação. Era deselegante interromper a palestra.
- Tem alguma pergunta? - perguntou Malcolm.
Um homem de trinta e poucos anos levantou-se no fundo da sala.
- Na verdade, uma observação - disse ele.
Era um homem moreno e magro, com camisa e short caqui, movimentos e modos precisos. Malcolm o reconheceu. Era um paleontólogo de Berkeley, chamado Levine,
que estava passando o verão no instituto. Malcolm jamais havia falado com ele, mas conhecia sua fama. A opinião geral era que Levine era o melhor paleobiólogo da
sua geração, talvez o melhor do mundo. Mas não era muito querido no instituto devido a sua arrogância e pompo-sidade.
- Eu concordo - disse Levine - que o registro fóssil não nos ajuda quando se trata da extinção. Especialmente se a sua tese consiste em afirmar que o comportamento
é a causa da extinção - porque os ossos não nos dizem muita coisa sobre comportamento. Mas discordo quando diz que sua tese não pode ser testada. Na realidade, ela
implica um resultado. Embora, talvez, o senhor não tenha ainda pensado nisso.
A sala ficou em silêncio. Malcolm franziu a testa. O matemático eminente não estava acostumado a ouvir dizer que não havia examinado a fundo as próprias idéias.
- Aonde quer chegar? - perguntou. Levine parecia indiferente à tensão na sala.
- Apenas a isto. Durante o Cretáceo, a espécie Dinosauria estava amplamente distribuída por todo o planeta. Temos encontrado seus restos em todos os continentes
e em todas as zonas climáticas - até na Antártica. Muito bem, se sua extinção foi realmente resultado do seu comportamento e não conseqüência de uma catástrofe,
uma doença ou uma mudança na vida das plantas, ou ainda qualquer das explicações de ampla escala que têm sido propostas, então parece pouco provável que todos tenham
mudado o comportamento ao mesmo tempo, em todos os lugares. Isso significa que possivelmente existem ainda alguns desses animais vivos na terra. Por que não pode
procurá-los?
- Você pode - disse Malcolm, friamente - se isso o diverte. E se não tiver nada mais importante no que empregar seu tempo.
- Não, não - disse Levine com urgência. - Falo sério. E se os dinossauros não foram extintos? Se existirem ainda? Em algum ponto isolado do planeta?
- Está falando de um Mundo Perdido - observou Malcolm e várias cabeças na sala balançaram concordando. Os cientistas do instituto haviam criado uma terminologia
para designar cenários evolucionários comuns. Falavam em Campo de Balas, Ruína do Jogador, o Jogo da Vida, o Mundo Perdido, a Rainha de Copas e o Ruído Negro. Eram
meios bem-definidos de pensar na evolução. Mas eram todos...
- Não - insistiu Levine. - Estou falando literalmente.
- Então está redondamente enganado. - Malcolm abanou a mão, descartando o assunto. Deu as costas para o auditório e foi para o quadro-negro. - Muito bem,
se considerarmos as implicações do limite do caos, podemos começar por perguntar qual é a menor unidade de vida? A maioria das definições contemporâneas da vida
inclui a presença do DNA, mas existem dois exemplos que nos sugerem que essa definição seja por demais limitada. Se considerarmos os vírus e os chamados príons,
concluiremos que, na realidade, a vida pode existir sem o DNA...
No fundo da sala, Levine ficou imóvel por um momento; depois, com relutância, voltou a sentar e começou a tomar notas.

A HIPÓTESE DO MUNDO PERDIDO


Terminada a palestra, Malcolm atravessou claudicando o pátio aberto do instituto, logo depois do meio-dia. Ao lado dele caminhava Sarah Harding, uma jovem
bióloga visitante, vinda da África. Malcolm a conhecia há vários anos, desde que fora convidado para ser o orientador externo da tese de doutorado de Sarah, na Universidade
de Berkeley, Califórnia.
Sob o sol do verão, formavam um par desigual. Malcolm, vestido de preto, ascético, ombros curvados para a frente, apoiado na bengala. Harding, compacta e
musculosa, muito jovem e cheia de energia, com short e camiseta, o cabelo preto curto preso pelos óculos escuros no alto da cabeça. Seu estudo de campo eram os predadores
da África, leões e hienas. Ia voltar para Nairóbi no dia seguinte.
A amizade dos dois havia se solidificado desde o acidente sofrido por Malcolm. Harding estava de férias em Austin e ajudou a cuidar dele durante a convalescença,
depois das várias operações a que fora submetido. Durante algum tempo parecia que estava nascendo um romance e que Malcolm, um solteirão empedernido, ia finalmente
construir uma família. Mas então Harding voltou para a África e Malcolm foi para Santa Fé. Fosse qual fosse o tipo de relacionamento que tiveram antes, agora eram
apenas bons amigos.
Falavam sobre as questões que haviam surgido no final da palestra. Na opinião de Malcolm, todas as objeções foram previsíveis. Que a extinção em massa é importante,
que os seres humanos devem sua existência à extinção do Cretáceo, que havia eliminado os dinossauros, permitindo o domínio dos mamíferos. Como um dos presentes dissera
afetadamente,"O Cretáceo permitiu o surgimento de nossa consiência sensível neste planeta."
A resposta de Malcolm fora imediata: "O que o faz pensar que os seres humanos são sensíveis e conscientes? Não há evidência disso. Os seres humanos jamais
pensam por si mesmos, acham extremamente desconfortável. A maior parte dos membros da nossa espécie simplesmente repete o que ouve dizer - e fica perturbada quando
é exposta a uma opinião diferente. O traço humano mais característico não é a consciência, mas o conformismo, e essa característica tem como resultado o conflito
religioso. Os outros animais lutam por território e por alimento, mas os seres humanos, diferentes de todo o resto do reino animal, lutam por suas 'crenças'. Isso
porque a crença dirige o comportamento, que tem grande importância evolutiva entre os seres humanos. Porém, numa época em que nosso comportamento pode nos levar
à extinção, não vejo razão para supor um mínimo de consciência na nossa espécie. Somos conformistas autodestrutivos e obstinados. Qualquer outra visão da nossa espécie
não passa de autocongra-tulação, ilusão. A pergunta seguinte." ;
Atravessando o pátio, ao lado dele, Sarah Harding disse, rindo:
- Eles não gostaram muito disso.
- Admito que é desanimador. Mas não se pode fazer nada. - Balançou a cabeça. - Esses são alguns dos melhores cientistas do país e mesmo assim... sem nenhuma
idéia interessante. A propósito, qual é a história daquele homem que me interrompeu?
- Richard Levine? - Ela riu. - Irritante, não é? Tem fama no mundo inteiro de ser um chato de galocha.
Malcolm resmungou.
- Eu que o diga.
- O problema é que ele é rico - disse Harding. - Já ouviu falar nas bonecas Becky?
- Não. - Malcolm olhou rapidamente para ela.
- Pois todas as meninas da América conhecem. É uma série, Becky, Sally e Francês, e muitas mais. São bonecas americanas. Levine é o herdeiro da empresa. Portanto,
ele é um garoto rico e sabichão. Impetuoso, faz tudo o que quer.
Malcolm balançou a cabeça, concordando.

- Tem tempo para almoçar?
- Claro, eu ficaria...
- Dr. Malcolm! Espere! Por favor! Dr. Malcolm! Malcolm olhou para trás. Richard Levine, alto e magro, corria
em direção a eles.
- Oh, droga - disse Malcolm.
- Dr. Malcolm - disse Levine. - Fiquei surpreso por ver que não levou mais a sério minha proposição.
- Como era possível? É absurda.
- Sim, mas...
- A senhora Harding e eu vamos almoçar - disse Malcolm, indicando Sarah com um gesto.
- Sim, mas acho que devia reconsiderar - insistiu Levine. - Porque acredito que meu argumento é válido - é completamente possível, até mesmo provável que
ainda existam dinossauros. Deve saber que há rumores persistentes sobre animais na Costa Rica, onde, se não me engano, você passou algum tempo.
- Sim, e no caso da Costa Rica posso dizer que...
- Também no Congo - continuou Levine - Há anos os pigmeus vêm falando de um grande saurópode, talvez até mesmo um apatossauro na floresta densa da Birmânia.
Também nas selvas de Irian Jaya supostamente existe um animal do tamanho de um rinoceronte, que pode ser um remanescente dos ceratopsianos...
- Fantasia - disse Malcolm. - Pura fantasia. Nada jamais foi visto. Nenhuma fotografia. Nenhuma prova material.
- Talvez não - disse Levine. - Mas a ausência de prova não é prova de ausência. Acredito que pode muito bem haver um local desses animais, sobreviventes dos
tempos passados.
Malcolm deu de ombros.
- Qualquer coisa é possível - disse ele.
- Mas aponta para o fato de que a sobrevivência é possível - insistiu Levine. - Estou sempre recebendo telefonemas sobre animais na Costa Rica. Remanescentes,
fragmentos.
Depois de uma pausa, Malcolm perguntou:
- Recentemente?
- Não, há algum tempo.
- Foi o que pensei.
- A última notícia foi há nove meses - disse Levine. - Eu estava na Sibéria examinando aquele filhote de mamute congelado e não consegui voltar a tempo. Mas
disseram que era o mesmo tipo de lagarto, atípico e muito grande, encontrado morto na selva da Costa Rica.
- E então? O que aconteceu com ele?
- Os restos foram queimados.
- Então não sobrou nada?
- Nada.
- Nenhuma foto? Nenhuma prova?
- Aparentemente hão.
- Então não passa de invenção - disse Malcolm.
- Talvez. Mas acredito que valha a pena organizar uma expedição para descobrir o que há a respeito desses supostos sobreviventes.
Malcolm olhou severamente para ele.
- Uma expedição? Para procurar um Mundo Perdido hipotético? Quem vai pagar?
- Eu - disse Levine. - Já dei início aos planos preliminares.
- Mas isso pode custar...
- Não me importa quanto possa custar - disse Levine. - O fato é que é possível que haja sobreviventes. Já ocorreram em várias espécies de outros gêneros e
pode haver também sobreviventes do período Cretáceo.
- Fantasia - Malcolm disse outra vez, balançando a cabeça. Levine olhou para Malcolm.
- Dr. Malcolm, devo dizer que sua atitude me surpreende. Acaba de apresentar uma tese e eu estou oferecendo uma chance de prová-la. Eu tinha certeza de que
saltaria imediatamente para não perder essa oportunidade.
- Meu tempo de saltar já passou - disse Malcolm.
- Mas, em vez de contra-argumentar, você...
- Não estou interessado em dinossauros.
- Mas todo o mundo está interessado em dinossauros.
- Eu não. - Girou a bengala e começou a andar.
- A propósito - disse Levine -, o que estava fazendo na Costa Rica? Ouvi dizer que passou quase um ano lá.
- Eu estava num leito de hospital. Passei meses na unidade de tratamento intensivo. Eu não podia sequer ser levado para um avião.
- Sim - disse Levine. - Sei que sofreu um acidente. Mas, antes disso, o que estava fazendo lá? Não estava procurando dinossauros?
Malcolm olhou para ele, entrecerrando os olhos para o sol e apoiou o peso do corpo na bengala.
- Não - ele disse. - Não estava.

Os três estavam sentados a uma pequena mesa pintada num canto do Café Guadalupe, no outro lado do rio. Sarah Harding tomava Corona na garrafa e observava
os dois homens. Levine parecia satisfeito por estar com eles, como se o fato de estar ali fosse uma vitória. Malcolm parecia cansado, como um pai que passou tempo
demais com um filho hiperativo.
- Quer saber o que eu ouvi? - disse Levine. - Ouvi dizer que alguns anos atrás uma empresa chamada InGen criou geneticamente alguns dinossauros e os pôs numa
ilha da Costa Rica. Mas alguma coisa saiu errada, muita gente foi morta e os dinossauros foram destruídos. Agora, ninguém fala a respeito por causa de alguma determinação
legal. Acordos de guardar sigilo sobre a matéria, ou coisa parecida. E o governo da Costa Rica não quer prejudicar o turismo. Por isso ninguém diz nada, foi o que
eu ouvi.
Malcolm olhou para ele.
- E acredita nisso?
- A princípio não acreditei. Mas o caso é que continuei ouvindo a história. Os rumores flutuam por toda a parte. Supostamente, você, Alan Grant e um punhado
de outros estavam lá.
- Perguntou a Grant?
- Perguntei, no ano passado, numa conferência em Pequim. Ele disse que é absurdo.
Malcolm balançou a cabeça lentamente.
- É isso o que você diz? - Levine perguntou, tomando a cerveja. - Quero dizer, você conhece Grant, não conhece?
- Não, nunca fomos apresentados. Levine o observava atentamente.
- Então não é verdade?
Malcolm suspirou.
- Por acaso conhece o conceito de tecnomito? Foi criado por Geller, em Princeton. A tese básica é de que nós perdemos todos os velhos mitos, Orfeu e Eurídice,
Perseu e Medusa. E preenchemos o vazio com o tecnomito moderno. Geller fez uma relação de uns doze mais ou menos. Um deles diz que um alienígena mora num hangar
na Base da Força Aérea em Wright-Patterson. Outro diz que alguém inventou um carburador que permite percorrer duzentos e quarenta quilômetros com quatro litros de
combustível, mas os fabricantes de automóveis compraram a patente e não permitem que seja usada. Há também a história de que os russos treinavam crianças em percepção
extra-sensorial numa base secreta na Sibéria e que essas crianças podem matar pessoas em qualquer lugar do mundo só com a força do pensamento. A história de que
em Nazca, Peru, há um aeroporto espacial alienígena. Que a CIA espalhou o vírus da AIDS para matar os homossexuais. Que Nikola Tesla descobriu uma fonte de energia
incrível mas suas anotações foram perdidas. Que em Istambul existe uma gravura do século X mostrando a Terra vista do espaço. Que o Instituto de Pesquisas de Stanford
encontrou um homem cujo corpo brilha no escuro. Dá para entender o que quero dizer?
- Está dizendo que os dinossauros do InGen são um mito - disse Levine.
- É claro que são. Têm de ser. Acha possível criar um dinossauro geneticamente?
- Todos os especialistas me dizem que não.
- Pois estão certos - disse Malcolm. Olhou para Harding, como para pedir confirmação. Ela não disse nada e continuou tomando cerveja.
Na verdade, Harding sabia algo mais sobre esses rumores a respeito de dinossauros. Certa vez, depois de uma cirurgia, Malcolm estava delirando, murmurando
incoerentemente ainda sob o efeito da anestesia e dos analgésicos. E ele parecia apavorado, debaten-do-se na cama, repetindo os nomes de vários tipos de dinossauros.
Harding perguntou à enfermeira de que se tratava, e ela disse que isso acontecia sempre depois de cada operação. O pessoal do hospital supunha que fosse uma fantasia
provocada pelos medicamentos - mas para Harding parecia que Malcolm estava revivendo uma experiência real apavorante. Essa idéia era reforçada pelo modo familiar
com que Malcolm se referia aos dinossauros. Ele os chamava de "raptores", "comps" e "trikes". E parecia ter medo especialmente dos raptores.
Mais tarde, quando ele já estava em casa, Sarah perguntou o que significavam aqueles delírios. Malcolm deu de ombros e fez uma piada sem graça: "Pelo menos
eu não disse os nomes de outras mulheres, disse?" Depois fez um comentário a respeito de ser fanático por dinossauros quando criança e de como a doença nos faz regredir
no tempo. Sua atitude era de indiferença forçada, como se não fosse importante. Harding teve a impressão exata de que ele estava sendo evasivo. Mas ela não pretendia
insistir. Naquele tempo estava apaixonada por ele e o tratava com indulgência.
Agora Malcolm olhava para ela interrogativamente, como perguntando se ia contradizê-lo. Harding limitou-se a erguer uma sobrancelha, com os olhos nos dele.
Malcolm devia ter suas razões. Ela podia esperar que chegasse a hora da revelação.
Levine se inclinou para Malcolm e disse:
- Então a história da InGen é completamente falsa?
- Completamente falsa - Malcolm respondeu, balançando a cabeça, muito sério. - Completamente falsa.

Há três anos Malcolm vinha negando a especulação sobre o assunto. Agora estava ficando muito bom nisso. Seu cansaço já não era afetado, mas genuíno. Na verdade,
ele foi um dos consultores da International Genetic Technologies em Paio Alto, no verão de 1989, e foi à Costa Rica a trabalho para a empresa, numa viagem que terminou
desastrosamente. Depois da catástrofe, todos foram de opinião de que a história devia permanecer em segredo. A ÍnGen queria limitar suas despesas. O governo da Costa
Rica queria preservar a fama de paraíso turístico. E os cientistas individualmente se comprometeram a guardar segredo e foram mais tarde regiamente recompensados
para garantir seu silêncio. No caso de Malcolm, a empresa pagou dois anos de tratamento médico.
As instalações da InGenn a ilha da Costa Rica foram destruídas. Já não havia nenhuma criatura viva na ilha. A empresa contratou o eminente professor de Stanford,
George Baselton, biólogo e ensaísta cuja presença freqüente em programas de televisão o havia tornado uma autoridade popular em assuntos científicos. Baselton afirmou
que havia visitado a ilha e negou categoricamente os rumores de que animais pré-históricos haviam existido no local. Sua frase zombeteira, "Ora, francamente, tigres
dente-de-sabre!", contribuiu bastante para reforçar a negativa.
Com o passar do tempo, o interesse diminuiu. A InGen há muito fora à falência. Os principais investidores da Europa e da Ásia arcaram com as perdas. Embora
os bens físicos da empresa, os prédios e o equipamento de laboratório tenham sido leiloados, resolveram que a tecnologia de base por eles desenvolvida jamais seria
vendida. Resumindo, o capítulo da InGen estava fechado.,
Não havia nada mais para dizer.

- Então não há nenhuma verdade na história - disse Levine, dando uma mordida no tamale de milho verde. - Para ser franco, Dr. Malcolm, agora sinto-me melhor.
- Por quê? - quis saber Malcolm.
- Porque significa que os remanescentes que aparecem na Costa Rica devem ser reais. Dinossauros de verdade. Tenho um amigo de Ya-le na Costa Rica, biólogo
de campo, e ele disse que já os viu. Acredito nele.
Malcolm deu de ombros.
- Eu duvido que qualquer animal apareça na Costa Rica.
- É verdade que nenhum animal aparece na região há um ano. Mas se outros aparecerem, vou até lá. Enquanto isso, vou preparar uma expedição. Tenho pensado
muito em como deve ser organizada. Acho que os veículos especiais podem ser fabricados em um ano. Já falei com o Dr. Thorne a respeito. Depois, vou formar uma equipe,
talvez incluir a Dra. Harding ou outro naturalista tão conceituado quanto ela e alguns estudantes de graduação...
Malcolm ouvia, balançando a cabeça.
- Acha que estou perdendo tempo - disse Levine.
- Sim, eu acho.
- Mas suponha - apenas suponha - que os animais comecem a aparecer outra vez.
- Nunca acontece.
- Mas suponha que eles apareçam - insistiu Levine. - Estaria interessado em me ajudar? A planejar uma expedição?
Malcolm terminou seu jantar e empurrou o prato para o lado. Olhou para Levine.
- Sim - disse, finalmente. - Se os animais começarem a aparecer novamente, estarei interessado em ajudá-lo.
- Ótimo - disse Levine. - E só o que eu queria saber.

Na rua Guadalupe, sob o sol forte, Malcolm e Sarah caminharam para o velho Ford seda do cientista. Levine entrou numa Ferrari vermelha, acenou alegremente
e partiu.
- Acha que isso pode acontecer? - perguntou Sarah Harding. - Que esses animais podem começar a aparecer outra vez?
- Não - respondeu Malcolm. - Tenho certeza de que nunca mais aparecerão.
- Parece que é o que você deseja.
Ele balançou a cabeça e entrou no carro com dificuldade, ajeitando a perna sob a direção. Harding sentou ao lado dele. Malcolm olhou rapidamente para ela
e ligou o motor. Voltaram para o instituto.

No dia seguinte Sarah voltou para a África. Nos dezoito meses seguintes, ficou mais ou menos a par dos progressos de Levine porque uma vez ou outra ele telefonava
para perguntar alguma coisa sobre protocolo do trabalho de campo, pneus de veículos ou qual o melhor anestésico para animais selvagens. O Dr. Thorne, encarregado
dos veículos, também telefonava ocasionalmente. Quase sempre parecia embaraçado.
De Malcolm ela não teve nenhuma notícia, a não ser o cartão que ele mandou no seu aniversário e chegou com um mês de atraso. Malcolm escreveu: "Feliz aniversário.
Fique feliz por não estar perto dele. O homem está me deixando louco."


PRIMEIRA CONFIGURAÇÃO

Na região conservativa, distante do limite do caos, os elementos
individuais aglutinam-se lentamente,
sem nenhum padrão definido.


IAN MALCOLM


FORMAS ABERRANTES


À luz imprecisa do fim de tarde, o helicóptero sobrevoou a costa, acompanhando a linha onde a selva encontrava a praia. Há dez minutos haviam passado sobre
a última aldeia de pescadores. Agora viam apenas a selva impenetrável da Costa Rica, pântanos, mangues e quilômetros e mais quilômetros de areia deserta. Ao lado
do piloto, Marty Guitierrez olhava para baixo, para a linha da costa. Não havia nem estradas naquela região, pelo menos nenhuma que Guitierrez pudesse ver.
Guitierrez era um americano tranqüilo de trinta e seis anos, usava barba, um biólogo de campo que foi há oito anos para a Costa Rica para estudar as espécies
dos tucanos na floresta tropical e acabou ficando como consultor da Reserva Biológica de Carara, o parque nacional, ao norte. Ligou o microfone do rádio e perguntou
para o piloto:
- Quanto falta ainda?
- Cinco minutos, senhor Guitierrez. Guitierrez virou para trás e disse:
- Não vai demorar.
Mas o homem alto, no banco de trás do helicóptero, não respondeu. Na verdade, nem pareceu ter ouvido. Continuou imóvel, com a mão no queixo, olhando pela
janela com a testa franzida.
Richard Levine estava de calça e jaqueta caqui desbotadas e chapéu de aba larga australiano enfiado na cabeça quase até os olhos. Um binóculo muito usado
pendia do seu pescoço. Porém, apesar da aparência descuidada, seu ar era de atenção erudita. Sob os óculos com aros de metal, os traços eram fortes e a expressão,
intensa e crítica.

- Que lugar é este?
- Chamam de Rojas.
- Então estamos bem ao sul.
- Estamos. A cerca de oitenta quilômetros da fronteira com o Panamá.
Levine olhou para a selva.
- Não vejo nenhuma estrada. Como foi que encontraram essa coisa?
- Um casal que estava acampando - disse Guítierrez. - Vieram de barco, aportaram na praia.
- Quando foi isso?
- Ontem. Deram uma olhada na coisa e saíram correndo.
Levine fez um gesto afirmativo. Com as pernas longas dobradas sobre o banco, as mãos debaixo do queixo, parecia um louva-a-deus. Esse era seu apelido no curso
de graduação, em parte por causa da sua aparência, em parte por causa da sua tendência a decepar com os dentes a cabeça de todos os que discordavam dele.
Guitierrez disse:
- Já esteve na Costa Rica antes?
- Não. É a primeira vez. - Depois, com um gesto irritado da mão, indicou que não estava disposto a falar sobre coisas sem importância.
Guitierrez sorriu. Depois de tantos anos, Levine continuava o mesmo. Era ainda um dos mais brilhantes e mais irritantes homens de ciência. Os dois haviam
estudado juntos no curso de graduação de Yale, até Levine abandonar o programa de doutorado para, se formar em zoologia comparada. Levine disse que não se interessava
pela pesquisa de campo contemporânea que tanto atraía Guitierrez. Com seu desdém característico, certa vez descreveu o trabalho de Guitierrez como "coleta de cocô
de papagaio pelo mundo afora".
A verdade era que Levine - brilhante e exigente - sentia-se atraído pelo passado, pelo mundo que já não existia. E estudava esse mundo com intensidade obsessiva.
Sua memória fotográfica era famosa, bem como a arrogância, a língua ferina e o prazer indisfarçável em apontar os erros dos colegas. Como disse um colega certa vez:
"Levine jamais esquece uma controvérsia - e jamais nos deixa esquecer."
Os pesquisadores de campo não gostavam de Levine e o sentimento era mútuo. No fundo ele era um detalhista, um catalogador da vida animal, e sentia-se feliz
estudando as coleções dos museus, corrigindo as categorias das espécies, reconstruindo os esqueletos expostos. Não gostava da poeira e dos inconvenientes da vida
no campo de estudo. Por sua vontade, Levine jamais sairia do museu. Mas era seu destino viver no maior período de descobertas da história da paleontologia. O número
de espécies conhecidas de dinossauros tinha duplicado nos últimos vinte anos e novas espécies eram descritas, numa média de uma a cada sete semanas. Assim, a fama
mundial de Levine o obrigava a viajar continuamente pelo mundo todo, examinando novas descobertas e dando sua opinião abalizada a pesquisadores que só a contragosto
admitiam que precisavam dela.
- De onde você veio? - perguntou Guitierrez.
- Mongólia. Eu estava no deserto de Gobi, a três horas de Ulan Bator.
- E mesmo? E o que há por lá?
- John Roxton tem uma escavação. Ele descobriu um esqueleto incompleto e pensou que se tratasse de uma nova espécie de Velocirraptor. Queria a minha opinião.
-E?
Levine deu de ombros.
- Na verdade, Roxton jamais conheceu coisa alguma de anatomia. E um hábil levantador de fundos, mas, quando descobre alguma coisa, não tem competência para
continuar o trabalho. - Disse isso a ele?
- Por que não? E a verdade.
- E o esqueleto?
- O esqueleto não era de um raptor. Os ossos do metatarso são completamente diferentes, o púbis muito ventral, o ísquio sem um obturador adequado e os ossos
longos leves demais. Quanto ao crânio... - Levine virou os olhos para o alto. - O palato muito espesso, as fenestras orbitais anteriores muito frontais, a carina
distai muito pequena... e assim por diante. A saliência ungular quase inexistente. E isso. Não sei o que Roxton estava pensando. Suspeito que se trate de uma subespecie
de Trodon, mas ainda não tenho certeza.
- Trodon ? - perguntou Guitierrez. - Um pequeno carnívoro do Cretáceo, dois metros dos pés ao acetábulo. Na verdade, um terópodo bastante comum. E o que
Roxton descobriu não é um exemplo especialmente interessante. Contudo, havia um detalhe curioso. O material incluía um artefato intergumental - uma marca de pele
de dinossauro. Não é um achado raro. Até hoje já foram obtidas pelo menos uma dezena de boas impressões de pele, a maior parte entre os Hadrosauridal. Mas nenhuma
igual a essa, uma vez que sem dúvida alguma essa pele de animal possui certas características incomuns nunca antes atribuídas aos dinossauros...
- Senores - o piloto interrompeu. - Estamos chegando à baía de Juan Fernández.
- E possível circular um pouco sobre ela antes de descer? - pediu Levine.
Levine olhou pela janela, intensamente atento outra vez, a conversa esquecida. Estavam sobrevoando a selva, que se estendia por quilômetros e quilômetros
nas encostas das colinas, até se perder de vista. O helicóptero virou para um lado para sobrevoar a praia.
- Lá está - disse Guitierrez, apontando para fora da janela.

A praia era um crescente limpo e branco, completamente deserta na luz do fim do dia. Para o sul viram a massa compacta e escura na areia. Lá de cima parecia
uma rocha, ou talvez um monte de algas marinhas. Era informe, com mais ou menos um metro e meio de largura. Em volta dela havia uma porção de pegadas.
- Quem esteve aqui? - perguntou Levine, com um suspiro.
- O pessoal do Serviço de Saúde Pública esteve na praia esta manhã.
- Fizeram alguma coisa? Tocaram no animal ou alteraram sua posição?
- Não sei dizer - respondeu Guitierrez.
- O Serviço de Saúde Pública - disse Levine, balançando a cabeça. - O que eles sabem? Marty, não devia ter deixado que chegassem perto.
- Ei, eu não governo o país. Fiz o melhor possível. Eles queriam destruir tudo antes mesmo de você chegar. Pelo menos consegui manter o animal intacto até
agora. Mas não sei até quando vão esperar.
- Então é melhor começar o trabalho - disse Levine. Apertou o botão do microfone. - Por que estamos ainda circulando? Estamos perdendo a luz do dia. Desça
na praia agora. Quero ver aquela coisa em primeira mão.
Richard Levine correu pela areia na direção da forma escura, com o binóculo balançando sobre o peito. Mesmo à distância ele sentia o cheiro da deterioração.
E já começava a anotar suas primeiras impressões. A carcaça estava semi-enterrada na areia, cercada por uma espessa nuvem de moscas. A pele estava entumescida, cheia
de gás, o que dificultava a identificação.
Levine parou a poucos metros da criatura e tirou a câmera da mochila. Imediatamente o piloto do helicóptero se aproximou e abaixou a mão dele.
- No permitido.
- O quê?
- Desculpe, senor. Não é permitido tirar fotos.
- Por que diabo não é permitido? - perguntou Levine. Virou para Guitierrez que corria na praia na direção deles. - Marty, por que não fotografias? Isto pode
ser uma importante...
- Nada de fotografias - disse o piloto, tirando a câmera das mãos de Levine.
- Marty, isto é coisa de louco.
- Vá em frente e faça seu exame - disse Guitierrez, e começou a falar em espanhol com o piloto, que respondia nervoso e autoritário, gesticulando agitado.
Levine olhou para os dois por um momento e virou para o animal morto. Para o diabo com tudo aquilo, pensou. Eles podem ficar discutindo pelo resto da noite.
Correu para a frente, respirando pela boca. O cheiro era muito mais forte de perto. Embora a carcaça fosse grande, ele notou a ausência de pássaros, ratos ou outros
necrófagos. Só havia moscas - um enxame tão denso que cobria toda a pele, obscurecendo os contornos do animal.
Mesmo assim, via-se que se tratava de uma criatura grande, mais ou menos do tamanho de uma vaca ou um cavalo, antes de começar a inchar. A pele estava rachada
pelo calor do sol e começava a descascar, expondo a camada subdérmica, amarela e pegajosa.
Nossa, como fedia! Levine fez uma careta. Com esforço tentou voltar toda a atenção para o animal morto.
Podia ter o tamanho de uma vaca, mas não era um mamífero. Não tinha pêlos. A cor original aparentemente era verde, com uma sugestão de listras mais escuras.
A superfície epidérmica era coberta por tubérculos poligonais de vários tamanhos, num padrão que lembrava a pele de um lagarto. A textura variava nas diferentes
partes, os tubérculos maiores e menos distintos na parte inferior da barriga. Havia grandes dobras de pele no pescoço, nós ombros e nas juntas das ancas - mais uma
vez lembrando um lagarto.
Mas a carcaça era grande. Levine estimou que o animal devia pesar originalmente cerca de cem ou cento e dez quilos. Nenhum lagarto crescia tanto, em nenhuma
parte do mundo, exceto os dragões komodo da Indonésia. Os Varanus komodoensis eram lagartos monitores com dois metros e setenta de comprimento, carnívoros do tamanho
de crocodilos que devoravam cabras e porcos, e às vezes seres humanos. Mas não havia lagartos monitores em nenhum lugar do Novo Mundo. É claro que este podia ser
um espécime dos Iguanidae. Os iguanas podiam ser encontrados em toda a América do Sul e os iguanas marinhos eram bem grandes. Mesmo assim, o tamanho desse animal
era um recorde.
Levine caminhou lentamente em volta da carcaça, na direção da frente do animal. Não, pensou ele, não é um lagarto. A carcaça está de lado, com as costelas
do lado esquerdo viradas para cima. Quase a metade estava enterrada na areia. A fileira de protuberâncias que marcavam o progresso da espinha dorsal estava poucos
centímetros acima da areia. O pescoço longo, curvado, a cabeça escondida sob o corpo, como a cabeça de um pato sob as penas. Levine viu uma pata dianteira, que parecia
pequena e fraca. O apêndice distai estava enterrado na areia. Pretendia cavar e examinar, mas precisava tirar algumas fotos antes de alterar a posição do espécime
in situ.
Na verdade, quanto mais Levine examinava a carcaça, mais se convencia de que precisava proceder com cuidado. Porque uma coisa estava clara - era um animal
muito raro e possivelmente desconhecido. Levine sentia um misto de entusiasmo e cautela. Se aquela descoberta fosse tão importante quanto ele começava a pensar,
então era essencial documentar adequadamente.
Na praia Guitierrez continuava gritando com o piloto, que continuava a balançar a cabeça teimosamente. A burocracia da república das bananas, pensou Levine.
Porque não podia fotografar? Não ia fazer mal nenhum. E era de vital importância documentar o estado de mudança da criatura.
Ouviu um zumbido e, ao olhar para cima, avistou um segundo helicóptero sobrevoando a baía, a sombra escura deslizando na areia. Era branco como uma ambulância,
com letras vermelhas num dos lados. Estava contra a luz do sol poente, e não conseguiu ler.
Levine voltou para a carcaça, notando que a perna traseira do animal era forte e musculosa, muito diferente da perna dianteira. Sugeria que a criatura andava
de pé, apoiada nas fortes pernas traseiras. Muitos lagartos andam assim, é claro, mas nenhum do tamanho daquele. Na verdade, quanto mais Levine observava os vários
aspectos da carcaça, mais se convencia de que não era um lagarto.
Procurou apressar seu exame do animal porque a luz do sol estava cada vez mais fraca e ele tinha muito que fazer ainda. No estudo de qualquer espécime deviam
ser feitas duas perguntas igualmente importantes. Primeira, que animal era aquele? Segunda, qual a causa da sua morte?
Examinando a anca do animal, viu uma estreita laceração na pele, sem dúvida devida à expansão dos gases subcutâneos. Porém, quando olhou com maior atenção,
verificou que era um corte profundo que se estendia por toda a extensão do fêmur e da tíbia, expondo o músculo vermelho e o osso sob ele. Levine se aproximou, ignorando
o cheiro e os vermes brancos que se moviam nos tecidos expostos da laceração porque compreendeu que...
- Eu sinto muito - disse Guitierrez, aproximando-se dele. - Mas o piloto se recusa a dar permissão.
O piloto parou ao lado de Guitierrez, observando nervosamen-te os dois homens.
- Marty - disse Levine. - Eu realmente preciso tirar algumas fotos.
- Infelizmente, não é possível. - Guitierrez deu de ombros.
- É importante, Marty.
- Sinto, mas já fiz o possível.
Adiante, na praia, o helicóptero branco aterrissou na areia e o ruído do motor diminuiu. Homens uniformizados começaram a desembarcar.
- Marty, o que você acha que é este animal?
- Bem, só posso dar um palpite - respondeu Guitierrez. - A julgar pelas dimensões gerais, eu diria que é um iguana nunca antes identificado. É extremamente
volumoso, é claro, e evidentemente não-nativo da Costa Rica. Meu palpite é que veio das ilhas Galápagos, ou da...
- Não, Marty - disse Levine. - Não é um iguana.
- Antes que você diga mais alguma coisa - Guitierrez olhou rapidamente para o piloto -, precisa saber que várias espécies desconhecidas de lagartos têm aparecido
nesta área. Ninguém sabe ao certo por quê. Talvez por causa de desmatamentos na floresta tropical, ou outra coisa qualquer. Mas estão aparecendo espécies novas.
Há alguns anos têm aparecido espécies não-identificadas de...
- Marty. Não é um maldito lagarto. Guitierrez piscou os olhos.
- O que está dizendo? É claro que é um lagarto.
- Acho que não é - insistiu Levine.
- Provavelmente você está se deixando enganar pelo tamanho. O fato é que aqui, na Costa Rica, ocasionalmente encontramos essas formas aberrantes...
- Marty - Levine interrompeu. - Eu nunca me deixo enganar.
- Bem, é claro, eu não quis dizer isso...
- Estou dizendo que não é um lagarto.
- Desculpe - Guitierrez balançou a cabeça. - Mas não posso concordar com você.
Os homens, reunidos ao lado do helicóptero, estavam pondo máscaras cirúrgicas.
- Não estou pedindo que concorde comigo - disse Levine, voltando para a carcaça. - O diagnóstico pode ser estabelecido facilmente, tudo o que temos a fazer
é escavar para tirar da areia a cabeça, ou um dos membros, por exemplo, este aqui, que eu acredito...
Não terminou a frase e se inclinou para a frente. Examinou a parte anterior da coxa do animal.
- O que é? - perguntou Guitierrez.
- Dê-me seu canivete.
- Para quê?
- Apenas me dê o canivete.
Guitierrez tirou o canivete do bolso e o entregou com o cabo voltado para Levine, que olhou atentamente para a carcaça.
- Acho que vai achar isto interessante.
- O quê?
- Acompanhando a linha posterior da derme há um...
De repente ouviram gritos na praia e viram os homens do helicóptero correndo para eles. Carregavam tanques de metal nas costas e gritavam em espanhol.
- O que estão dizendo? - perguntou Levine, franzindo a testa. Guitierrez suspirou.
- Estão mandando que nos afastemos.
- Diga que estamos ocupados. - Levine se inclinou outra vez para o animal.
Mas os gritos continuaram. De repente ouviram algo como um rugido furioso, e, erguendo os olhos, Levine viu os lança-chamas ligados lançando enormes jatos
de fogo à luz do fim do dia. Ele deu a volta na carcaça e correu para os homens, gritando:
- Não! Não!
Mas ninguém deu atenção. Ele gritou.
- Não, isto é um precioso...
O primeiro homem uniformizado segurou Levine e o jogou violentamente na areia.
- Que diabo estão fazendo? - Levine berrou, levantando-se. Mas, antes de acabar de falar, viu que era tarde demais. As
primeiras chamas tinham alcançado a carcaça, escurecendo a pele, acendendo as bolas de metano com um puft azulado. A fumaça espessa começou a subir para o
céu.
- Parem! Parem! - Levine virou para Guitierrez. - Mande parar com isso!
Mas Guitierrez estava imóvel, olhando para a carcaça. Consumido pelas chamas, o torso se abriu e a gordura saiu em jatos. Então, a pele toda foi queimada,
as costelas negras e grossas apareceram, o torso inteiro girou, e de repente o pescoço do animal se ergueu, no meio das chamas, movendo-se à medida que a pele se
contraía. E no interior do fogo Levine viu um focinho longo e pontudo com fileiras de dentes agudos e predadores, órbitas vazias, tudo queimando, como um dragão
medieval subindo ao céu em chamas.

SAN JOSÉ


Sentado no bar do aeroporto, Levine tomava vagarosamente sua cerveja, esperando o avião que o levaria de volta aos Estados Unidos. Guitierrez, na frente dele
no outro lado da pequena mesa, não parecia disposto a conversar. Há alguns minutos os dois guardavam um silêncio um tanto embaraçoso. Guitierrez olhou para a mochila
de Levine no chão, a seus pés. Era de Gore-Tex verde-escuro, feita por encomenda, com bolsos extras no lado de fora para todo o material eletrônico.
- Uma bela mochila - ele disse. - Onde a comprou? Parece uma mala de Thorne.
- É uma mala de Thorne. - Levine tomou um gole de cerveja.
- Bonita - repetiu Guitierrez, olhando para a mochila. - O que você tem aí na primeira bolsa, um telefone via satélite? Nossa, não sei o que mais vão inventar.
Muito legal. Deve ter custado uma...
- Marty - disse Levine, impaciente. - Pare com essa conversa mole. Vai me contar ou não?
- Contar o quê?
- Quero saber que diabo está acontecendo aqui.
- Richard, escute, eu sinto muito se você...
- Não - interrompeu Levine. - Aquele espécime lá na praia era muito importante, Marty, e foi destruído. Não compreendo como você permitiu que isso acontecesse.
Guitierrez suspirou. Olhou para os turistas na outra mesa e disse:
- Mas isto tem de ser confidencial, está bem?
- Tudo bem.
- Há um grande problema aqui.
- Que problema?
- Têm aparecido... bem... formas aberrantes na costa, uma vez ou outra. Há anos isso vem acontecendo.
- Formas aberrantes? - repetiu Levine, balançando a cabeça, incrédulo.
- Esse é o termo oficial para esses espécimes - explicou Guitierrez. - Ninguém no governo quer ser mais preciso. Começou mais ou menos há cinco anos. Alguns
animais foram descobertos nas montanhas, perto de uma remota estação agrícola que cultivava variedades experimentais de feijão-soja.
- Feijão-soja - repetiu Levine.
Guitierrez fez que sim com a cabeça.
- Aparentemente esses animais são atraídos por feijões e certas relvas. A suposição é de que precisam muito do aminoácido lisina na sua dieta. Porém ninguém
tem certeza. Talvez apenas gostem de certos vegetais...
- Marty - disse Levine. - Não me importa se eles gostam de cerveja e batatas fritas. A única coisa importante é saber de onde vêm.
- Ninguém sabe.
Levine ficou calado por um momento.
- O que aconteceu com esses animais?
- Foram destruídos. E, pelo que eu sei, nenhum outro apareceu durante anos. Mas agora parece que está recomeçando. No ano passado encontramos os restos de
quatro animais, incluindo o que você viu hoje.
- E o que foi feito?
- As... formas aberrantes sempre são destruídas. Exatamente como você viu. Desde o começo o governo tem feito o possível para garantir que ninguém fique sabendo.
Alguns anos atrás, alguns jornais americanos começaram a dizer que havia alguma coisa estranha numa das ilhas, a Islã Nublar. Menendez convidou um grupo de jornalistas
para uma visita especial à ilha - e mandou levá-los de helicóptero a outra ilha. Eles nem perceberam a diferença. Coisas desse tipo. Quero dizer, o governo está
encarando o problema com muita seriedade.

- Porquê?
- Estão preocupados.
- Preocupados? Por que ficar preocupado com... Guitierrez levantou a mão, mudou de posição na cadeira,
aproximando-se mais de Levine.
- Doença, Levine.
- Doença?
- Isso mesmo. A Costa Rica tem um dos melhores sistemas de assistência à saúde do mundo - disse Guitierrez. - Os epidemiologistas estão procurando a origem
de um tipo estranho de encefalite, cujo número de casos vêm aumentando, especialmente na costa.
- Encefalite? De qual origem? Viral? Guitierrez balançou a cabeça.
- Não foi encontrado nenhum agente causador da doença.
- Marty...
- É como estou dizendo, Richard. Ninguém sabe. Não é um vírus porque não há aumento da titulação de anticorpos e nenhuma mudança nos diferenciais dos glóbulos
brancos. Não é uma bactéria porque não foi possível nenhuma cultura. E um mistério. Tudo o que os epidemiologistas sabem é que parece afetar especialmente os habitantes
da zona rural, pessoas que convivem com animais. E é uma encefalite verdadeira - dores de cabeça lancinantes, confusão mental, febre, delírio...
- Mortalidade?
- Até agora parece autolimitada, dura mais ou menos três semanas. Mas mesmo assim o governo está preocupado. O país depende do turismo, Richard. Ninguém
quer falar sobre doenças desconhecidas.
- Então eles pensam que a encefalite está relacionada às formas aberrantes?
Guitierrez deu de ombros.
- Os lagartos transportam certa variedade de doenças virais. Constituem um vetor conhecido. Portanto, a conexão não é de todo sem propósito.
- Mas você disse que não é uma doença viral.
- Seja o que for. Eles pensam que há uma relação.
- Mais uma razão para descobrir de onde vêm esses lagartos
- observou Levine. - Certamente eles devem ter procurado...
- Procurado? - Guitierrez riu. - É claro que procuraram. Revistaram cada centímetro do país, vezes sem conta. Organizaram dezenas de grupos de busca - eu
mesmo conduzi alguns. Fizeram reconhecimento aéreo. Sobrevoaram a selva. Sobrevoaram as ilhas distantes da costa. Só isso já constitui um grande trabalho. Como sabe,
há muitas ilhas, especialmente na costa oeste. Diabo, eles até deram busca nas ilhas particulares.
- Existem ilhas particulares? - perguntou Levine.
- Algumas. Três ou quatro. Como a Islã Nublar... uma empresa americana, a InGen, teve um leasing durante anos.
- Mas você disse que essa ilha foi revistada...
- Minuciosamente. Não encontraram nada.
- Eas outras?
- Bem, deixe ver. - Guitierrez começou a contar nos dedos.
- Há a Islã Talamanca, na costa leste, onde fica o Club Med. A Sorna, na costa oeste, arrendada por uma empresa alemã de mineração. E a Morazan, ao norte,
propriedade de uma família rica da Costa Rica. Pode haver outras que não lembro no momento.
- E o que eles encontraram?
- Nada - disse Guitierrez. - Não encontraram coisa alguma. Assim, supõe-se que os animais venham de algum ponto remoto da selva. E por isso não conseguimos
ainda encontrar.
Levine resmungou.
- Nesse caso, só com muita sorte.
- Eu sei. A floresta tropical é o ambiente perfeito para se esconder. Um grupo de busca pode passar a poucos metros de um animal sem vê-lo. Nem os sensores
remotos da mais avançada tecnologia ajudam muito porque precisam penetrar várias camadas
- nuvens, copas das árvores, flora rasteira. É quase praticamente impenetrável. Qualquer coisa pode se esconder na floresta tropical. Seja como for - continuou
ele - o governo está frustrado. E é claro que não é o único interessado no caso.
Levine ergueu os olhos rapidamente.
-Oh?
- Sim. Por algum motivo, parece que é muito grande o interesse por esses animais.
- Que tipo de interesse? - Levine procurou parecer o mais calmo possível.
- No outono passado, o governo concedeu permissão a um grupo de botânicos da Berkeley para fazer um reconhecimento aéreo das copas das árvores da selva no
planalto central. Estavam trabalhando há um mês quando surgiu uma questão sobre o pagamento do combustível do avião, ou coisa parecida. Seja como for, um burocrata
de San José telefonou para Berkeley reclamando. E Berkeley disse que não sabia nada sobre o tal grupo de estudo. Nesse ínterim, o grupo fugiu do país.
- Então, ninguém sabe quem eles são?
- Ninguém. Então, no último inverno, dois geólogos suíços apareceram para coletar amostras nas ilhas ao longo da costa, segundo eles como parte de um estudo
das atividades vulcânicas na América Central. As ilhas ao largo da costa são todas vulcânicas e a maioria com vulcões relativamente ativos; portanto, parecia uma
requisição razoável. Mas no fim os "geólogos" trabalhavam para uma empresa americana de genética chamada Biosyn e estavam procurando, bem... animais grandes nas
ilhas.
- Por que uma empresa de biotecnologia estaria interessada? - perguntou Levine. - Não faz sentido.
- Talvez não para você e para mim, mas a Biosyn não tem boa fama. O chefe de pesquisa é um cara chamado Lewis Dodgson.
- Oh, sim - disse Levine - Eu sei. O cara que fez aquele teste com vacina anti-rábica no Chile há alguns anos. O teste em que expunham os agricultores à raiva
sem dizer o que estavam fazendo.
- Esse mesmo. Ele também começou um teste de mercado de uma batata criada pela engenharia genética, nos supermercados, sem dizer a ninguém que era um produto
alterado. Provocou diarréia nas crianças, algumas foram parar no hospital. Depois disso, a empresa teve de contratar George Baselton para consertar Nua imagem.
- Parece que todo o mundo contrata Baselton - disse Levine. Guitierrez deu de ombros.
- Hoje em dia, os professores universitários de grande nome dão consultorias. Faz parte do negócio. E Baselton é catedrático de biologia. A companhia precisava
dele para limpar a sujeira porque Dodgson tinha o hábito de violar a lei. Dodgson tem gente do mundo inteiro na folha de pagamentos. Roubam as pesquisas de outras
empresas, fazem de tudo. Dizem que a Biosyn é a única empresa de engenharia genética com mais advogados do que cientistas.
- E por que estavam interessados na Costa Rica? Guitierrez deu de ombros outra vez.
- Eu não sei, mas toda a atitude para com a pesquisa está mudada, Richard. Isso é bastante evidente aqui. A Costa Rica tem uma das ecologias mais ricas do
mundo. Meio milhão de espécies em doze hábitats ambientais diferentes. Cinco por cento de todas as espécies do planeta estão representadas aqui. Este país tem sido
durante anos um centro de pesquisa biológica e, posso garantir, as coisas estão mudando. Nos velhos tempos, as pessoas que vinham para cá eram cientistas dedicados
que queriam aprender tudo, só por amor ao conhecimento e ao estudo - macacos-gritadores, vespas polistinas, plantas sombrilla. Pessoas que tinham escolhido seus
campos de estudo porque gostavam do que faziam. Certamente não iam enriquecer com isso. Mas agora tudo na biosfera tem valor potencial. Ninguém sabe de onde vai
sair o próximo medicamento, e por isso as empresas farmacêuticas criam todo o tipo de fundo de pesquisa. Talvez o ovo de um pássaro tenha proteínas capazes de inibir
a coagulação do sangue. Talvez a superfície cerosa de uma samambaia contenha um analgésico. A atitude para com a pesquisa está mudando. As pessoas já não estudam
o mundo natural, mas estão fazendo um trabalho de extração. E uma mentalidade de saqueador. Qualquer coisa nova ou desconhecida automaticamente é interessante porque
pode ter algum valor. Pode valer uma fortuna.
Guitierrez terminou a cerveja.
- O mundo - disse ele - está de cabeça para baixo. E o fato é que muita gente quer saber o que representam esses animais aberrantes, e de onde vêm.
O alto-falante anunciou o vôo de Levine. Os dois levantaram da mesa e Guitierrez disse:
- Vai guardar segredo? Quero dizer, de tudo que viu hoje?
- Para ser franco - respondeu Levine -, eu não sei o que vi hoje. Podia ser qualquer coisa.
Guitierrez sorriu.
- Boa viagem, Richard.
- Cuide-se, Marty.


A PARTIDA


Com a mochila nas costas, Levine dirigiu-se para a sala de embarque. Voltou-se para acenar um adeus, mas Guitierrez já caminhava para a saída, com o braço
levantado para chamar o táxi. Levine deu de ombros e continuou seu caminho.
Logo adiante ficava o balcão de controle de passaportes, com uma fila na frente. Levine tinha reservado passagem no vôo noturno para San Francisco com uma
longa escala na Cidade do México. A fila não estava muito longa. Provavelmente tinha tempo de telefonar para o escritório e avisar à sua secretária Linda a hora
do vôo. Talvez, pensou, devesse também ligar para Malcolm. Olhou em volta e viu a fileira de telefones com a indicação ICT Teléfonos International, na parede da
direita, mas eram poucos e estavam todos ocupados. Era melhor usar o telefone-satélite, pensou, tirando a mochila dos ombros, e talvez fosse melhor...
Levine parou, pensando.
Olhou outra vez para a parede.
Quatro pessoas estavam usando os telefones. A primeira era uma mulher loura de short e top, balançando num braço uma criança queimada de sol enquanto falava.
O segundo era um homem de barba com uma jaqueta safári, que olhava constantemente para o Rolex que tinha no pulso. A terceira era uma mulher grisalha, falando espanhol,
enquanto os dois filhos adultos, ao seu lado, balançavam enfaticamente as cabeças confirmando o que ela dizia.
A última pessoa nos telefones era o piloto do helicóptero. Não estava com o paletó do uniforme, mas com uma camisa de mangas curtas e gravata. Estava virado
para a parede com os ombros curvados para a frente.
Levine aproximou-se dele e ouviu que o piloto falava inglês. Levine pôs a mochila no chão e, enquanto ouvia, fingiu que estava ajustando as tiras. O piloto
continuava de costas para ele.
Levine ouviu o homem dizer: "Não, não, professor. Não é isso. Não." Uma pausa e ele disse: "Não, eu estou dizendo que não, desculpe, professor Baselton, mas
não sabemos. É uma ilha, mas qual delas... Precisamos esperar mais informações. Não, ele vai partir esta noite. Não, acho que ele não sabe de nada e não tirou nenhuma
foto. Não. Eu compreendo. Adiós."
Levine abaixou a cabeça quando o piloto passou apressado na direção do balcão da LACSA, na outra extremidade do aeroporto.
Que diabo é isso?, pensou Levine.
É uma ilha, mas qual delas...
Como sabiam que era uma ilha? O próprio Levine não tinha certeza. E há algum tempo vinha estudando a fundo esses achados, dia e noite, tentando encaixar todas
as partes. De onde os animais tinham vindo? Por que aquilo estava acontecendo?
Levine foi para um canto onde não podia ser visto e tirou da mochila o pequeno telefone-satélite. Digitou rapidamente um número de telefone em San Francisco.
A ligação foi rápida, clicando quando entrou em contato com o satélite. O telefone no outro lado começou a tocar. Depois um bip e uma voz eletrônica disse:
"Por favor, digite seu código de acesso."
Levine digitou os seis números.
Outro bip. A voz eletrônica disse: "Deixe sua mensagem."
- Estou telefonando - disse Levine - para dar o resultado da viagem. Único espécime, não em boa forma. Localização: BB-17 no seu mapa. Isso fica bem ao sul,
o que combina com todas as nossas hipóteses. Não consegui uma identificação exata antes de queimarem o espécime. Mas acredito que fosse um ornitolestes. Como você
sabe, esse animal não está na lista - um achado extremamente significativo.
Olhou em volta, mas não viu ninguém por perto, ninguém prestando atenção nele. Continuou: "Além disso, havia um corte profundo na parte lateral do fêmur.
Isso é extremamente estranho." Hesitou, não querendo falar demais. "E estou enviando uma amostra que precisa ser examinada. Penso também que outras pessoas estejam
interessadas. Seja como for, o que está acontecendo aqui é algo novo, Ian. Há mais de um ano não aparecia nenhum espécime e agora estão voltando a aparecer. Algo
novo está acontecendo. E nós não compreendemos o que é."
Ou será que compreendemos?, pensou Levine. Desligou o telefone e o guardou na bolsa externa da mochila. Talvez, pensou ele, saibamos mais do que pensamos.
Olhou pensativamente para o portão de embarque. Estava na hora de tomar o avião.

PALO ALTO


Às duas horas da manhã, Ed James entrou no estacionamento quase deserto do Marie Callender, na Carter Road. O BM Wpreto já estava lá, estacionado perto da
entrada. De onde estava ele avistou Dodgson sentado a uma mesa entre divisórias baixas, no restaurante, o rosto de traços pouco marcados contraído. Dodgson nunca
estava de bom humor. Naquele momento ele falava com o homem enorme que estava ao seu lado e olhava impaciente para o relógio. O homem grande era Baselton. O professor
que aparecia sempre na televisão. James ficava mais tranqüilo quando o professor estava presente. Dodgson dava calafrios a qualquer um, mas era difícil imaginar
Baselton envolvido com alguma coisa irregular.
James desligou o motor e abaixou o retrovisor para abotoar o colarinho e pôr a gravata. Olhou para o espelho rapidamente - um homem cansado e despenteado
com uma barba de dois dias. Que diabo, pensou. Como não parecer cansado? Já era o meio da maldita noite.
Dodgson sempre marcava os encontros para o meio da noite e sempre no mesmo bendito restaurante, Marie Callender. James não entendia por quê. O café era horrível.
Mas afinal havia muita coisa que ele não entendia.
Apanhou o envelope de papel pardo, saiu do carro e bateu a porta. Caminhou para a entrada, balançando a cabeça. Há semanas Dodgson estava pagando a ele quinhentos
dólares por dia para vigiar alguns cientistas. No começo, James pensou que fosse um tipo de espionagem industrial. Mas nenhum dos cientistas trabalhava para a indústria,
todos eram professores da universidade, especializados em matérias extremamente áridas. Como aquela paleobotânica Sattler, cuja especialidade eram grãos de pólen
pré-histórico. James havia assistido a uma das suas aulas na Berkeley e mal conseguiu ficar acordado até o fim. Um slide após o outro de esferas pálidas que pareciam
bolas de algodão, enquanto ela falava sem parar sobre ângulos de ligação de polissacarídeos e sobre a fronteira Campanian-Maastrichtian. Jesus, era uma chatice.
Certamente não valia quinhentos dólares por dia, pensou ele. Entrou no restaurante, piscando para a luz, e foi direto para a mesa de Dodgson. Sentou, cumprimentou
os dois homens com uma inclinação da cabeça e levantou a mão para pedir café.
Dodgson olhou furioso para ele.
- Eu não tenho a noite toda - ele disse. - Vamos começar.
- Certo - disse James, abaixando a mão. - Ótimo, claro. - Abriu o envelope e começou a tirar papéis e fotos, que ia entregando para Dodgson enquanto falava.
- Alan Grant: paleontólogo na Universidade de Montana. No momento está de licença em Paris, fazendo palestras sobre os últimos dinossauros descobertos. Aparentemente
tem algumas idéias novas sobre o fato de os tiranossauros serem necrófagos e...
- Deixe pra lá - disse Dodgson. - Vamos adiante.
- Ellen Sattler Reiman - disse James, empurrando para ele uma foto. - Botânica, teve um envolvimento com Grant. Agora está casada com um físico da Berkeley
e tem um casal de filhos pequenos. Ela leciona meio-período na universidade. Passa o resto do tempo em casa porque...
- Adiante, adiante.
- Bem. Quase todos os outros estão mortos. Donald Gennaro, advogado... morreu de disenteria numa viagem de negócios. Dennis Nedry, Integrated Computer Systems...
também morto. John Hammond, que fundou a International Genetic Technologies... morreu quando visitava o complexo de pesquisa da empresa, na Costa Rica. Hammond estava
com os netos. Os netos moram com a mãe no Leste e...
- Alguém entrou em contato com eles? Alguém da InGen?
- Não. Nenhum contato. O garoto está começando o segundo grau e a menina está na escola preparatória. Então a InGen entrou com pedido de concordata, depois
da morte de Hammond. Está nos tribunais desde a morte dele. Os bens materiais finalmente começaram a ser vendidos. Nas duas últimas semanas, para ser exato. Baselton
falou pela primeira vez.
- O Sítio B está envolvido na venda?
James não entendeu.
- Sítio B?
- Sim. Ninguém mencionou o Sítio B?
- Não, nunca ouvi falar. O que é?
- Se ouvir alguma coisa sobre o Sítio B, queremos saber - disse Baselton.
Sentado ao lado de Baselton, Dodgson olhou rapidamente para as fotos e os papéis com informações, depois empurrou tudo para o lado, impaciente, e olhou para
James.
- O que mais você tem?
- Isso é tudo, Dr. Dodgson.
- Isso é tudo? Nada sobre Malcolm? E Levine? Ainda são amigos?
James consultou suas anotações.
- Não tenho certeza. Baselton franziu a testa.
- Não tem certeza? O que quer dizer com isso?
- Malcolm conheceu Levine no Instituto Santa Fé - disse James. - Passaram algum tempo lá há dois anos mais ou menos. Mas Malcolm não tem estado em Santa
Fé recentemente. Está dando uma série de palestras na Berkeley como professor visitante do departamento de biologia. Leciona modelos matemáticos da evolução. E ao
que parece perdeu contato com Levine.
- Eles cortaram relações?
- Talvez. Ouvi dizer que discutiram sobre a expedição de Levine.
- Que expedição? - perguntou Dodgson, inclinando-se para a frente.
- Há um ano mais ou menos Levine está planejando um tipo de expedição. Encomendou veículos especiais a uma empresa chamada Mobile Field Systems. É uma fábrica
pequena em Wnodside, dirigida por um cara chamado Jack Thorne. Thorne adapta jipes e caminhões para cientistas que fazem pesquisa de campo. Cientistas na África,
Sichuan e no Chile garantem a qualidade do seu trabalho.
- Malcolm sabe da expedição?
- Deve saber. Ele vai ocasionalmente à empresa de Thorne. Uma vez por mês, mais ou menos. E Levine tem ido lá todos os dias, é claro. Foi assim que ele foi
parar na cadeia.
- Na cadeia? - perguntou Baselton.
- Isso mesmo - disse James, consultando suas anotações. - Vejamos. Dez de fevereiro. Levine foi detido por dirigir a cento e noventa numa zona de velocidade
máxima permitida de vinte quilômetros. Bem na frente de um colégio em Woodside. O juiz apreendeu a Ferrari dele, tirou sua licença e o condenou a prestar serviços
à comunidade. Basicamente, ordenou que desse aulas no colégio.
Baselton sorriu.
- Richard Levine lecionando num colégio. Eu gostaria de ver.
- Ele tem cumprido a pena conscienciosamente. De qualquer modo, tem passado muito tempo em Woodside. Isto é, até sair do país.
- Quando ele saiu do país? - perguntou Dodgson.
- Há dois dias. Foi à Costa Rica. Viagem rápida. Devia voltar esta manhã.
- E onde ele está agora?
- Eu não sei. E acho que, bem, não vai ser fácil encontrá-lo.
- Por quê?
James hesitou, tossiu.
- Porque seu nome constava da relação de passageiros do vôo da Costa Rica, mas ele não estava a bordo quando o avião chegou aqui. Meu contato na Costa Rica
diz que ele saiu do hotel em San José antes da hora do vôo e não voltou. Não tomou nenhum outro avião para sair da cidade. Assim, neste momento, acho que Richard
Levine desapareceu.

Durante o longo silêncio que se seguiu, Dodgson recostou no banco, assobiando entre os dentes. Olhou para Baselton, que balançou a cabeça. Dodgson apanhou
os papéis cuidadosamente e os empilhou, batendo-os na mesa. Depois os guardou no envelope de papel pardo e entregou para James.
- Agora escute, seu cretino filho da mãe - disse Dodgson. - Quero só uma coisa de você. E muito simples. Está ouvindo?
James engoliu em seco.
- Estou ouvindo.
Dodgson inclinou-se sobre a mesa.
- Encontre Levine - disse ele.

BERKELEY


Malcolm ergueu os olhos quando sua assistente Beverly entrou no escritório atulhado de livros e papéis. Ela estava acompanhada por um homem do DHL que carregava
uma pequena caixa.
- Desculpe a intrusão, Dr. Malcolm, mas o senhor precisa assinar estes formulários... É aquela amostra da Costa Rica.
Malcolm levantou e foi até o centro da sala, sem usar a bengala. Há algumas semanas ele vinha se exercitando para andar sem a bengala. Sentia ainda alguma
dor na perna, mas estava resolvido a fazer progresso. Sua fisioterapeuta, Cindy, uma mulher sempre alegre e otimista, comentou:
- Muito bem, Dr. Malcolm, depois de tantos anos finalmente parece que está motivado. O que está acontecendo?
- Bem, você sabe - disse Malcolm. - Não posso depender de uma bengala para sempre.
Mas a verdade era outra. A animação indestrutível de Levine pela hipótese do mundo perdido, seus telefonemas entusiasmados, a qualquer hora do dia ou da noite,
levaram Malcolm a reconsiderar sua opinião sobre o assunto. E começou a acreditar que fosse possível - até mesmo provável - a existência de animais extintos em algum
lugar remoto e até então não imaginado. Malcolm tinha suas razões para pensar assim, razões apenas sugeridas a Levine.
Mas foi a possibilidade de existir esse local em outra ilha que o levou a se livrar da bengala. Queria estar preparado para uma futura visita a essa ilha.
Assim, esforçava-se diariamente e com afinco para andar livremente.
Ele e Levine haviam limitado a área de busca a uma fileira de ilhas costeiras da Costa Rica e o entusiasmo de Levine era cada vez mais intenso. Mas para Malcolm
a possibilidade era ainda remota.
Malcolm recusava-se a se entusiasmar enquanto não tivesse uma prova material definitiva - fotografias ou amostras reais de tecido - da existência de novos
animais. Até agora não tinham nenhuma. Malcolm não sabia se estava desapontado ou aliviado.
Porém agora Levine havia enviado uma amostra.
Malcolm apanhou a prancheta do entregador e assinou rapidamente o formulário: Entrega de Material/Amostras: Pesquisa Biológica.
O entregador disse.
- Precisa verificar as caixas, senhor.
Malcolm olhou para a lista de perguntas, cada uma com um quadrado na frente para checar. O espécime é vivo? O espécime consta de cultura de bactérias, fungos,
vírus ou protozoários? O espécime está registrado de acordo com o protocolo de pesquisa? O espécime é contagioso? O espécime foi retirado de uma fazenda ou de algum
lugar de criação de animais domésticos? O espécime é matéria vegetal, sementes propagadoras ou bulbos? O espécime é um inseto ou relacionado com insetos...
Malcolm respondeu não a todas as perguntas.
- E a página seguinte, senhor - disse o entregador. Ele olhou em volta, para o escritório, para as pilhas desordenadas de papéis, os mapas nas paredes com
alfinetes de cabeças coloridas. - Fazem pesquisas médicas aqui?
Malcolm virou a página do formulário e assinou na parte inferior da segunda.
- Não.
- Mais um, senhor...
A terceira página era um recibo de quitação de responsabilidade para a agência entregadora. Malcolm assinou também. O homem disse:
- Um bom-dia para o senhor - e saiu. Imediatamente Malcolm relaxou o corpo, apoiando-se na mesa, e fez uma careta.
- Ainda sente dor? - perguntou Beverly. Ela levou o espécime até a mesa e começou a desembrulhar.
- Eu estou bem. - Olhou para a bengala ao lado da cadeira, depois respirou fundo e atravessou a sala, lentamente.
Beverly retirou o papel do pequeno cilindro de aço inoxidável do tamanho de um punho fechado, com o sinal de risco biológico na tampa superior, de atarraxar.
Ligado ao cilindro, havia um pequeno recipiente de metal com uma válvula também de metal que continha o gás refrigerador.
Malcolm virou a lâmpada de mesa para o cilindro e disse:
- Vamos ver o que o deixou tão entusiasmado. - Partiu o lacre e desaparafusou a tampa. O gás foi liberado com um pequeno silvo e uma nuvem de condensação.
O exterior do cilindro foi coberto por uma fina lâmina de gelo.
Malcolm olhou para dentro. Havia um pequeno saco de plástico e uma folha de papel. Virou o cilindro de cabeça para baixo, deixando cair o conteúdo na mesa.
Dentro do plástico estava um pedaço de carne esverdeada com cerca de cinco centímetros quadrados, com uma pequena etiqueta de plástico verde. Malcolm o ergueu contra
a luz, examinou com a lente de aumento e pôs na mesa outra vez. Olhou para a pele esverdeada, para a textura irregular. Talvez, pensou.
Talvez...
- Beverly - disse ele -, telefone para Elizabeth Gelman, no zoológico. Diga que quero que ela examine uma coisa para mim. E diga que é confidencial.
Beverly saiu da sala para telefonar. Sozinho, Malcolm desenrolou o papel que acompanhava a amostra. Era uma folha de um bloco de anotações e dizia, em letras
maiúsculas:

EU ESTAVA CERTO, E VOCÊ ESTAVA ERRADO.

Malcolm franziu a testa. Aquele filho da mãe, pensou ele.
- Beverly? Depois de falar com Elizabeth, telefone para o escritório de Levine. Preciso falar com ele imediatamente.

O MUNDO PERDIDO


Richard Levine encostou o rosto na rocha quente e parou para tomar fôlego. Cento e cinqüenta metros abaixo estava o oceano, as ondas cintilantes batendo com
força nas rochas escuras. O barco que o havia levado até ali era um pequeno ponto no horizonte, seguindo para leste. Tinha de voltar, pois não havia nenhum local
seguro para atracar naquela ilha deserta e inóspita.
Agora eles estavam sozinhos.
Levine respirou fundo e olhou para Diego, seis metros abaixo na face do rochedo. Diego, jovem e forte, carregava a mochila com todo o equipamento. Ele sorriu
alegremente e olhou para cima.
- Coragem, senor. Estamos perto agora.
- Espero que sim - disse Levine.
Quando ele observara o rochedo com o binóculo, do barco, aquele parecia um bom caminho para a escalada. Mas na realidade a face da rocha era quase vertical
e incrivelmente perigosa porque a rocha vulcânica era insegura e friável.
Levine ergueu os braços estendendo as mãos para o próximo ponto de apoio. Segurou a rocha, pequenas pedras se soltaram, e sua mão deslizou para baixo. Ele
agarrou outra vez e ergueu o corpo, com a respiração ofegante por causa do esforço e do medo.
- Só mais vinte metros, senor - encorajou Diego. - O senor vai conseguir.
- Claro que vou - resmungou Levine. - Considerando a alternativa...
A medida que se aproximava do topo do rochedo, o vento ficava mais forte, assobiando nos seus ouvidos, puxando sua roupa, como se quisesse arrancá-lo da rocha.
Olhou para cima e viu a folhagem densa que chegava até a margem da face da pedra.
Quase chegando, pensou. Quase.
Então, com um impulso final para cima, chegou ao topo e ficou imóvel, deitado na relva macia e molhada. Ainda respirando com dificuldade, olhou para baixo.
Diego subiu com facilidade e leveza, agachou no tapete de folhagem e sorriu. Levine olhou para as imensas samambaias acima da sua cabeça, respirando longa e tremulamente
para aliviar a tensão da escalada. Suas pernas estavam em fogo.
Mas não importava - estava ali finalmente!
Olhou para a selva. Era uma floresta primitiva, não tocada pela mão do homem. Exatamente o que as imagens do satélite haviam mostrado. Levine foi obrigado
a confiar nas fotos do satélite porque não havia mapas de ilhas particulares como aquela. A ilha existia numa espécie de mundo perdido, isolada no meio do Oceano
Pacífico.
Levine ouviu o som do vento, o farfalhar das folhas das palmeiras, com as gotas de água pingando no seu rosto. Depois ouviu outro som, distante, como o grito
de um pássaro, porém mais profundo, mais ressonante. Prestou atenção e o som se repetiu.
Ouviu outro ruído ao seu lado e virou rapidamente. Diego acabava de riscar um fósforo para acender o cigarro. Levine sentou de repente, empurrou a mão de
Diego e balançou a cabeça.
Diego olhou para ele, intrigado.
Levine levou um dedo aos lábios.
Apontou na direção do grito do pássaro.
Diego deu de ombros, desinteressado. Aparentemente não vi motivo para se preocupar.
Ele não sabe ainda o que vamos enfrentar, pensou Levine abrindo a sacola e começando a montar seu rifle Lindstradt, fabri cado especialmente para ele na Suécia
e que representava a mais nova tecnologia para controle de animais. Atarraxou o cano ao cabo travou o mecanismo de disparo, verificou a carga de gás e entregou o
rifle para Diego. O rapaz o aceitou com outro erguer de ombro
Levine tirou da mochila a pistola Lindstradt, preta e à prova de ferrugem, com o cinto de couro, e a prendeu na cintura. Tirou a pistola do coldre, verificou
o pino de segurança duas vezes e devolveu ao coldre. Levantou e fez sinal para Diego segui-lo. Diego fechou o zíper da mochila e a colocou nas costas.
Os dois homens começaram a descer a encosta, afastando-se do rochedo. Quase imediatamente suas roupas ficaram completamente molhadas em contato com a folhagem.
Estavam no meio da selva densa e só enxergavam alguns metros à frente. As folhas das samambaias eram enormes, longas e largas, com a envergadura de um homem. As
plantas tinham três metros de altura e hastes ásperas e pontiagudas. E no alto, acima das samambaias, as copas das árvores bloqueavam quase completamente a luz do
sol. Moviam-se no escuro, em silêncio, na terra úmida e esponjosa.
Levine parava freqüentemente para consultar a bússola. Seguiam para oeste, descendo uma encosta íngreme, na direção do interior da ilha, Ele sabia que a ilha
era o que restava de uma antiga cratera vulcânica, exposta à erosão durante séculos. A área interna consistia numa série de cordilheiras baixas que levavam ao chão
da Á cratera. Porém, especialmente ali, no lado leste, o solo era íngreme, acidentado e traiçoeiro.
A sensação de isolamento, de estar de volta ao mundo primitivo, era palpável. Com o coração batendo forte, Levine desceu a encosta, atravessou um regato cheio
de musgo e começou a subir novamente. No topo da cordilheira seguinte havia uma abertura na folhagem e uma brisa reparadora. De onde estava, no alto, ele via a outra
extremidade da ilha, uma linha de rochedos negros, a quilômetros de distância. Entre ele e os rochedos via apenas a selva ondulante. Ao lado dele, Diego disse:
- Fantástico.
Levine rapidamente fez um sinal de silêncio.
- Mas, senor - protestou Diego, apontando para a vista. - Estamos sozinhos aqui.
Levine balançou a cabeça com impaciência. Já havia explicado tudo isso a Diego durante a viagem de barco. Uma vez chegando à ilha, não deviam falar. Nada
de fixador de cabelo, água de colônia ou cigarros. Toda a comida estava hermeticamente fechada em sacos de plástico. Tudo acondicionado cuidadosamente. Nada que
pudesse exalar cheiro, nada que fizesse qualquer ruído. Vezes sem conta ele havia explicado a Diego a importância dessas precauções.
Mas era óbvio agora que Diego não prestara a menor atenção. Ele não compreendia. Levine tocou Diego com o cotovelo e balançou a cabeça outra vez, irritado.
Diego sorriu.
- Senor, por favor. Só há pássaros aqui.
Nesse momento ouviram um som profundo e trovejante, um grito que parecia extraterreno, vindo de algum lugar da floresta, abaixo de onde estavam. Depois de
um momento, responderam-lhe do outro lado da floresta.
Diego arregalou os olhos.
Levine disse só com um movimento dos lábios, "Pássaros ?"
Diego ficou calado, mordeu o lábio e olhou para a floresta.
Ao sul as copas das árvores começaram a se mover, uma parte da floresta de repente adquiriu vida, como que roçada pelo vento. Mas o resto continuava imóvel.
Não era o vento.
Diego fez o sinal da cruz.
Ouviram mais gritos, cada um com a duração de um minuto mais ou menos; depois, silêncio outra vez.
Levine desceu da pequena elevação e começou a descer a encosta, penetrando mais no interior da selva.

Levine caminhava rapidamente, olhando para o chão por causa das cobras, quando ouviu um assobio surdo. Virou para trás e viu Diego apontando para a esquerda.
Levine voltou, abrindo caminho entre a folhagem, e seguiu Diego para o sul. Logo chegaram a duas trilhas paralelas há muito tempo tomadas pela relva e pelas
samambaias, mas perfeitamente visíveis. Marcas de pneus de jipe, saindo da selva. É claro que seguiriam por ela. Andariam muito mais depressa numa estrada.
Levine fez um gesto e Diego tirou a mochila das costas. Era a vez do cientista carregar o peso e ele passou as tiras pelos ombros e prendeu as fivelas.
Em silêncio, seguiram pela trilha.
Em certos lugares mal podiam ver as marcas do jipe, cobertas pela vegetação espessa. Era evidente que ninguém transitava por ali há anos e a selva estava
sempre pronta para recuperar o espaço perdido.
Atrás dele Diego resmungou e praguejou em voz baixa. Levine voltou-se e viu Diego levantar o pé com cuidado. Tinha pisado num monte de excremento verde de
animal. Levine voltou.
Diego passou o pé nas samambaias para limpar a bota suja até o tornozelo. O excremento parecia consistir em pedaços claros de feno misturado com alguma coisa
verde. O material era leve e fragmentado - seco, antigo. Não tinha cheiro.
Levine examinou o solo até encontrar os restos das marcas da passagem do animal. Os excrementos eram bem-formados, com vinte centímetros de diâmetro. Definitivamente,
de um herbívoro de grande porte.
Diego estava em silêncio, mas de olhos arregalados.
Levine balançou a cabeça e continuou a andar. Enquanto estivessem encontrando sinais evidentes de herbívoros, não ia se preocupar. Pelo menos, não muito.
Mesmo assim, tocou o cabo da pistola, como para se tranqüilizar.

Chegaram a um regato com margens lamacentas nos dois lados. Levine parou. Na lama havia marcas definidas de pés de animais, com três dedos, algumas delas
bem grandes. Sua mão aberta não chegava a cobrir completamente as pegadas.
Ergueu os olhos e viu Diego fazendo o sinal da cruz outra vez, segurando o rifle com a outra mão.
Esperaram, ouvindo o murmúrio suave do regato. Alguma coisa brilhou na água. Levine se inclinou para a frente e apanhou um pedaço de tubo de vidro do tamanho
de um lápis, com uma das extremidades quebradas e marcas graduadas num dos lados. Era uma pípeta, do tipo usado nos laboratórios de todo o mundo, Levine a ergueu
contra a luz, girando-a entre os dedos. Estranho, pensou ele. Uma pipeta de laboratório sugeria...
Virou para o lado a tempo de notar um rápido movimento. Algo pequeno e marrom corria sobre a lama da margem do regato. Mais ou menos do tamanho de um rato.
Diego resmungou surpreso. Então, o animal desapareceu entre a folhagem.
Levine agachou na lama ao lado da água e examinou as marcas dos pés deixadas pelo pequeno animal. Pés com três dedos, como os de um pássaro. Viu outras marcas
iguais, algumas maiores, a poucos centímetros de distância.
Levine já vira essas marcas antes, nas trilhas do rio Purgatoire, no Colorado, onde a antiga linha da costa estava agora fossilizada, com as pegadas dos dinossauros
perpetuadas nas pedras. Mas essas estavam na lama, eram recentes e feitas por animais vivos.
Sentado nos calcanhares, Levine ouviu um leve rangido à sua direita. Viu o movimento suave das samambaias. Ficou imóvel, esperando.
Depois de algum tempo um animal espiou entre as samambaias. Parecia do tamanho de um camundongo, a pele lisa e sem pêlos, e olhos muito grandes bem no alto
da cabeça pequenina. Era marrom-esverdeado e guinchou para Levine, com um ruído contínuo e irritante, como procurando afastá-lo. Levine ficou imóvel, quase sem respirar.
E claro que ele reconheceu a criatura. Era um mussauro, um pequeno prossaurópodo de fins do Triássico. Restos de esqueletos desse animal só foram encontrados
na América do Sul. Era um dos menores dinossauros conhecidos.
Um dinossauro, pensou ele.
Embora esperasse encontrar dinossauros na ilha, era assustador estar frente a frente com um membro vivo e ativo da espécie Dinosauria. Especialmente um tão
pequeno. Mesmerizado, Levine não tirava os olhos do animal. Depois de todos aqueles anos, depois de todos os esqueletos empoeirados - um dinossauro realmente vivo!
O pequeno mussauro avançou um pouco, aventurando-se a deixar a proteção da folhagem. Levine viu então que ele era mais comprido que o que tinha pensado. Devia
ter uns dez centímetros de comprimento, com a cauda surpreendentemente forte. No aspecto geral, parecia um lagarto. Sentou ereto, apoiado nas patas traseiras. Levine
viu o movimento das costelas acompanhando a respiração. O animal agitou as pernas dianteiras para Levine, guinchando sem parar.
Lentamente, muito lentamente, Levine estendeu a mão.
A criatura guinchou outra vez, mas não fugiu. Tudo o que parecia demonstrar era curiosidade, inclinando a cabeça para o lado, como fazem os animais pequenos,
quando a mão de Levine chegou mais perto.
Finalmente os dedos de Levine tocaram a ponta da samambaia. O mussauro ficou de pé, equilibrando-se na cauda estendida. Sem o menor sinal de medo, ele subiu
na mão de Levine. Era extremamente leve. O mussauro deu uma volta na palma de Levine e cheirou os dedos. Levine sorriu, encantado.
De repente, a pequena criatura guinchou irritada, saltou da mão de Levine e desapareceu entre as árvores. Levine não compreendeu por quê.
Então sentiu um cheiro horrível e percebeu um movimento nos arbustos, no outro lado. Ouviu um rosnado surdo. Mais movimento entre os arbustos.
Por um breve momento Levine lembrou que os carnívoros selvagens costumam caçar perto dos rios e regatos, aproveitando a vulnerabilidade da presa, inclinada
para beber. Mas era tarde demais. Ouviu um brado estridente e apavorante e quando se voltou viu Diego aos gritos, sendo arrastado para os arbustos, que se agitavam
violentamente. Levine viu de relance um pé enorme com o dedo médio em forma de garra curva. Então o pé desapareceu. Os arbustos continuaram a se agitar.
De repente, a floresta em volta dele explodiu em rugidos de animais assustados. Viu um vulto enorme saltando para ele. Richard Levine virou e correu, sabendo
que não podia escapar. Algo pesado agarrou a mochila e ele caiu de joelhos na lama, compreendendo naquela fração de segundo que, a despeito de todo planejamento,
apesar de todas as suas deduções inteligentes, as coisas tinham saído terrivelmente erradas e ele ia morrer.

A ESCOLA


"Quando consideramos a extinção em massa provocada pelo impacto de um meteoro", disse Richard Levine, "devemos fazer várias perguntas. Em primeiro lugar,
existe no nosso planeta alguma cratera resultante da queda de um meteoro com mais de 30 quilômetros de diâmetro - o menor tamanho necessário para provocar uma extinção
de âmbito mundial? Acontece que existem uma dúzia de crateras desse tamanho no mundo todo, cinco das quais coincidem com períodos da extinção conhecidos..."
Kelly Curtis bocejou no escuro da sua classe da sétima série do primeiro grau. Sentada à mesa, com o queixo apoiado nas mãos cruzadas, ela se esforçava para
não dormir. Já conhecia toda aquela matéria. A televisão na frente da classe mostrava a vista aérea de um vasto milharal com os contornos curvos levemente visíveis.
Ela sabia que era a cratera de Manson. No escuro, a voz gravada do Dr. Levine dizia: "Esta é a cratera de Manson, Iowa, datada de sessenta e cinco milhões de anos,
exatamente quando os dinossauros foram extintos. Mas teria sido o meteoro o responsável pela extinção?"
Não, pensou Kelly, bocejando. Provavelmente a península de Yucatán. Manson era pequeno demais.
"Hoje pensamos que esta cratera é demasiado pequena", disse o Dr. Levine. "Acreditamos que seja demasiado pequena numa ordem de magnitude, e a candidata atual
é a cratera perto de Mérida, na península de Yucatán. Parece difícil imaginar, mas o impacto esvaziou todo o Golfo do México, provocando ondas de seiscentos e dez
metros que se lançaram sobre a terra. Deve ter sido um espetáculo incrível. Porém há divergências a respeito desta cratera também, especialmente no que diz respeito
ao significado da estrutura em forma de poço natural e às diferenças nos índices de mortandade do fitoplâncton nos depósitos dos oceanos. Pode parecer complicado,
mas não se preocupem com isso agora. Falaremos a respeito com maiores detalhes na próxima aula. Assim, por hoje é tudo."
As luzes se acenderam. A professora, a Sra. Menzies, desligou o computador que estava transmitindo a aula.
- Muito bem - disse ela. - Ainda bem que o Dr. Levine nos mandou esta gravação. Ele me disse que talvez não voltasse em tempo para a aula de hoje, mas certamente
estará conosco na próxima semana, depois dos feriados, Kelly, você e Arby trabalham com o Dr. Levine. Foi isso o que ele disse?
Kelly olhou para Arby, que estava recostado na cadeira e franziu a testa.
- Sim, Sra. Menzies - afirmou Kelly.
- Ótimo. Muito bem. O dever para os feriados será todo o capítulo sete - gemidos gerais -, incluindo todos os exercícios no fim da primeira e da segunda
parte. Não deixem de trazer a lição completa quando voltarem às aulas. Aproveitem bem os feriados. Nós nos veremos novamente aqui dentro de uma semana.
A campainha soou, a turma se levantou, arrastando as cadeiras, na sala de repente barulhenta. Arby se aproximou de Kelly e olhou para ela tristemente. Arby
era quase uma cabeça mais baixo do que Kelly, o menor da classe e também o mais novo. Kelly tinha treze anos, como os outros alunos da sétima série, mas Arby tinha
só onze. Era tão inteligente que já havia saltado duas séries. E diziam que ia saltar mais uma. Arby era um gênio, especialmente com computadores.
Arby guardou a caneta no bolso da camisa social e empurrou para cima os óculos de aros de tartaruga. R. B. Benton era negro, NCU pai e sua mãe eram médicos
em San José e faziam questão de que ele estivesse sempre bem-vestido, como um aluno de faculdade ou coisa parecida. O que, pensou Kelly, ele sem dúvida seria dentro
de dois anos, se continuasse nesse ritmo.
Kelly sempre se sentia mal vestida e desajeitada ao lado de Arby. Ela usava as roupas da irmã mais velha, compradas na Kmart, pela mãe, há milhões de anos.
Tinha até de usar os velhos Reeboks de Emily, tão velhos e encardidos que nunca pareciam limpos, nem quando saíam da máquina de lavar. Sua mãe quase nunca estava
em casa. Kelly olhou com inveja para a calça de Arby, impecavelmente passada, os tênis brilhantes, e suspirou.
Porém, apesar da inveja que sentia, Arby era seu único amigo verdadeiro - a única pessoa que aceitava o fato de ela ser inteligente. Kelly tinha medo de nunca
mais vê-lo se ele saltasse para a nona série.
Arby parecia preocupado. Olhou para ela e disse:
- Por que o Dr. Levine não está aqui?
- Eu não sei. Talvez tenha acontecido alguma coisa.
- O quê, por exemplo? í
- Eu não sei. Qualquer coisa.
- Mas ele prometeu que estaria aqui - disse Arby. - Para nos levar numa excursão de estudo de campo. Estava tudo combinado. Conseguimos permissão e tudo o
mais.
- E daí? Ainda podemos ir.
- Mas ele devia estar aqui - insistiu Arby, teimosamente.
Kelly já conhecia aquele comportamento. Arby estava acostumado a confiar nos adultos. Seus pais eram completamente dignos de confiança. Mas Kelly não tinha
esse problema.
- Deixe pra lá, Arby. Vamos falar pessoalmente com o Dr. Thorne.
- Acha que devemos?
- Claro. Por que não? Arby hesitou.
- Talvez seja melhor eu telefonar para minha mãe primeiro.
- Por quê? Sabe que ela vai dizer para você ir direto para casa. Venha, Arby. Vamos.
Ele hesitou, ainda indeciso. Arby podia ser inteligente, mas qualquer mudança de planos o perturbava. Kelly sabia por experiência que ele ia resmungar e discutir
o tempo todo se ela fosse demasiado insistente. Precisava esperar que ele resolvesse.
- Tudo bem - Arby disse, finalmente. - Vamos falar com o Dr. Thorne.
Kelly disse, com um largo sorriso:
- Encontro você na frente, em cinco minutos.

Quando desceu a escada para o primeiro andar, a cantilena recomeçou: "Kelly é um crânio, Kelly é um crânio..."
Ela ergueu a cabeça. Era aquela idiota da Allison Stone com suas amigas idiotas, no fim da escada, provocando-a.
"Kelly é um crânio..."
Passou por elas, ignorando a provocação. Viu a Srta. Enders, a monitora, ali perto, como sempre não dando a menor atenção, embora o Sr. Canosa, o assistente
do diretor, tivesse recentemente advertido toda a escola a respeito de provocações desse tipo.
Atrás dela, as meninas continuaram: "Kelly é um crânio... Ela é a rainha... da tela... e vai ficar verde..." Todas se torciam de rir.
Viu Arby à sua espera ao lado da porta com um maço de cabos cinzentos na mão. Kelly se apressou.
Quando chegou perto dele, Arby disse:
- Esqueça.
- Elas são umas cretinas idiotas.
- Certo.
- Eu não me importo mesmo.
- Eu sei. Esqueça.
Atrás deles as meninas riam. "Kel-ly e Ar-by.... vão a uma festa... dar um banho de matemática..."
Saíram para a luz do sol e as vozes foram abafadas pela confusão da saída da escola. Os ônibus amarelos esperavam no estacionamento. Crianças desciam a escada
e corriam para os carros dos pais estacionados em volta da quadra. Era grande a atividade.
Arby se desviou de um Frisbee que passou por cima de sua cabeça e olhou para a rua.
- Lá está ele outra vez.
- Não olhe - disse Kelly.
- Não estou olhando.
- Lembre-se do que o Dr. Levine disse.
- Nossa, Kel, eu me lembro, está bem?
No outro lado da rua estava parado um Taurus cinzento que há dois meses Kelly e Arby viam uma vez ou outra. O motorista, que fingia ler um jornal, era o mesmo
homem de barbicha rala. Esse homem estava seguindo o Dr. Levine desde que ele começara a dar aulas na escola de Woodside. Kelly achava que fora especialmente por
isso que ele tinha pedido a ela e a Arby que fossem seus assistentes.

Levine havia dito que eles iam ajudá-lo a carregar equipamento, tirar xerox dos deveres de classe, recolher os trabalhos de casa e outras tarefas de rotina.
Para eles era uma grande honra trabalhar para o Dr. Levine- ou, de qualquer modo, seria interessante trabalhar para um cientista profissional -, e por isso aceitaram.
Mas acontece que não tinham nada para fazer na classe. O Dr. Levine fazia tudo. Em vez do trabalho combinado, ele os encarregava de pequenas tarefas fora
da classe. E recomendou que ficassem longe do homem de barba no carro. Isso não era difícil. O homem nem olhava para eles porque eram crianças.
O Dr. Levine explicou que o homem de barba o estava seguindo por causa de alguma coisa relacionada à sua prisão, mas Kelly não acreditou. Sua mãe fora detida
duas vezes por dirigir embriagada e nunca fora seguida. Kelly não sabia por que o homem seguia o Dr. Levine, mas era evidente que o cientista estava fazendo alguma
pesquisa e não queria que ninguém soubesse. De uma coisa Kelly sabia - o Dr. Levine não se importava muito com a classe. Geralmente dava a aula de improviso. Outras
vezes, chegava até a porta da escola, entregava um disquete com a aula e ia embora. Eles não sabiam para onde ele ia nesses dias.
As tarefas das quais o Dr. Levine os encarregava eram também misteriosas. Uma vez eles foram a Stanford para apanhar com um professor cinco pequenos quadrados
de plástico. O plástico era leve, um pouco esponjoso. Outra vez foram ao centro da cidade, a uma loja de artigos eletrônicos, para apanhar um objeto triangular que
o vendedor da loja entregou nervosamente, como se fosse uma coisa ilegal. Outra vez, ainda, foram apanhar um tubo de metal que parecia conter charutos. Curiosos,
eles o abriram e ficaram preocupados quando encontraram quatro ampolas de plástico fechadas com um líquido cor de palha. Nas ampolas estava escrito: PERIGO EXTREMO!
TOXIDEZ LETAL!, e tinha o símbolo de três lâminas que indicava risco biológico.
Mas a maior parte das tarefas era comum. Muitas vezes ele os mandou a bibliotecas de Stanford para tirar xerox de trabalhos sobre diversos assuntos: fabricação
de espadas pelos japoneses, raios X, cristalografia, morcegos vampiros mexicanos, vulcões da América Central, correntes oceânicas do El Nino, o acasalamento das
ovelhas das montanhas, toxidez das holotúrias, arcobotantes das catedrais góticas...
O Dr. Levine jamais explicava por que estava interessado nesses assuntos. Geralmente ele os mandava de volta dia após dia, à procura de mais material. E então,
de repente, ele desistia do assunto e nunca mais falava nele. E os dois assistentes passavam para outras tarefas.
É claro que alguma coisa eles compreendiam. Muitas das tarefas tinham a ver com o veículo que o Dr. Thorne estava fazendo para a expedição do Dr. Levine.
Porém, na maior parte das vezes, os assuntos eram completamente misteriosos.
Ocasionalmente Kelly imaginava o que o homem de barba pensava de tudo isso. Se ele sabia de alguma coisa que eles não sabiam. Mas, na verdade, o homem de
barba parecia um pouco preguiçoso. Aparentemente jamais descobriu que Kelly e Arby estavam trabalhando para o Dr. Levine.
Nesse momento, ele olhava para a porta da escola ignorando-os completamente. Os dois foram até o fim da rua e sentaram no banco para esperar o ônibus.


A ETIQUETA

O filhote de leopardo da neve cuspiu a mamadeira, rolou no chão, ficou de pernas para o ar e miou baixinho.
- Ela quer carinho - disse Elizabeth Gelman.
Malcolm estendeu a mão e acariciou a barriga do animalzinho. O filhote girou o corpo e cravou os pequenos dentes nos dedos dele.
- Dorje! Menina malvada! É assim que trata uma visita importante? - Segurou a mão de Malcolm e a examinou. - Nem abriu a pele, mas mesmo assim vamos limpar.
Estavam no laboratório de pesquisas do Zoológico de San Francisco. Eram três horas da tarde. Elizabeth Gelman, a jovem diretora do departamento de pesquisas,
devia entregar o relatório com o resultado do exame da amostra, mas Malcolm teve de esperar porque era a hora de alimentar os filhotes. Malcolm viu os funcionários
alimentarem um filhote de gorila, que cuspia como um bebê humano, um filhote de coala e finalmente o filhote de leopardo da neve.
- Desculpe - disse Gelman, levando-o para a pia e lavando a mão dele com sabão. - Mas achei que era melhor você vir aqui nesta hora, quando toda a equipe
está na reunião semanal.
- Por quê?
- Por que há muito interesse no material que você nos mandou, Ian. Muito. - Enxugou a mão dele com uma toalha e examinou outra vez. - Acho que vai sobreviver.
- O que você descobriu? - perguntou Malcolm.
- Tem de admitir que é bastante interessante. A propósito, é da Costa Rica?

Com voz inexpressiva, Malcolm disse:
- Por que pergunta?
- Por causa de todos esse boatos sobre animais desconhecidos que têm aparecido na Costa Rica. E este é definitivamente um animal desconhecido, Ian.
Saíram do berçário do zoológico e foram para uma pequena; sala de conferências. Malcolm sentou e encostou a bengala na mesa. Ela diminuiu as luzes e ligou
o projetor de slides.
- Muito bem. Aqui está um close do seu material original, antes de começarmos o exame. Como pode ver, consiste num fragmento de tecido animal em avançado
estado de necrose. O tecido mede quatro por seis centímetros. Preso a ele há uma etiqueta de plástico verde de dois centímetros quadrados. Tecido cortado com uma
faca não muito afiada.
Malcolm balançou a cabeça, afirmativamente.
- O que você usou, Malcolm? Um canivete?
- Alguma coisa parecida.
- Muito bem. Vamos primeiro ao tecido. - Passou para outro slide, que mostrava uma visão microscópica - Este é um corte histológico feito na epiderme superficial.
Essas lacunas manchadas e de bordas irregulares indicam a erosão na superfície do tecido, provocada pelas alterações necróticas. Porém o interessante é a disposição
das células epidérmicas. Pode-se ver a densidade dos cromatóforos ou células que contêm os pigmentos. Na parte seccionada vemos a diferença entre os melanóforos,
aqui, e os alóforos, ali. O padrão geral sugere um lacertílio.
- Quer dizer lagarto? - perguntou Malcolm.
- Sim. Parece um lagarto, embora o quadro não seja inteiramente consistente. - Bateu com o dedo no lado esquerdo da tela. - Está vendo esta célula aqui, com
uma margem levemente delineada no corte? Acreditamos que seja músculo. O cromatóforo pode abrir e fechar, isto é, este animal pode mudar de cor, como um camaleão.
E aqui, está vendo esta forma grande, oval com centro descorado? É o poro de uma glândula femoral. No centro há uma substância cerosa que ainda estamos analisando.
Mas supomos que o animal seja um macho, uma vez que só os lagartos machos possuem glândulas femorais.

- Compreendo - disse Malcolm.
Ela passou para outro slide. Malcolm viu o que parecia o close de uma esponja.
- Veja aqui a estrutura das camadas subcutâneas. Muito distorcidas por causa das bolhas de gás da infecção por Clostridium, que provocou o entumescimento
do corpo do animal. Mas dá para perceber os vasos - veja, um aqui e outro aqui - circundados por fibras musculares lisas. Isto não é característico dos lagartos.
Na verdade, tudo o que aparece neste slide nada tem a ver com lagartos ou com qualquer tipo de réptil.
- Está dizendo que parece um animal de sangue quente.
- Certo - disse Gelman. - Não na realidade mamífero, mas talvez da espécie dos pássaros. Pode ser, oh, eu não sei, um pelicano morto. Alguma coisa assim.
- Hum, hum.
- Só que nenhum pelicano tem a pele igual a esta.
- Compreendo - disse Malcolm.
- E não há penas.
- Hum, hum.
- Agora - disse Gelman -, conseguimos extrair uma quantidade mínima de sangue das artérias. Não muito, mas o suficiente para conduzir um exame microscópico.
Aqui está.
Passou para outro slide. Malcolm viu um amontoado de células, a maioria glóbulos vermelhos e um ou outro glóbulo branco malformado. Um tanto confuso.
- Esta não é a minha área, Elizabeth - ele disse.
- Bem, vou citar apenas os pontos principais. Para começar, glóbulos vermelhos com núcleos. E uma característica das aves, não dos mamíferos. Segundo, hemoglobina
bastante atípica, diferindo em vários pares tomados como base de outros lagartos. Terceiro ponto, estrutura aberrante dos glóbulos brancos. Não temos material suficiente
para determinar com exatidão, mas suspeitamos que esse animal possua um sistema imunológico extremamente incomum.
- E o que quer dizer isso? - Malcolm deu de ombros.
- Não sabemos e a amostra não nos dá material suficiente para descobrir. A propósito, pode arranjar outra?
- Talvez possa - disse ele.
- Onde, no Sítio B?
- Sítio B? - perguntou Malcolm, intrigado.
- Bem, é o que diz a etiqueta. - Ela passou para o slide seguinte. - Devo dizer, Ian, que esta etiqueta é muito interessante. Aqui, no zoológico, costumamos
pôr etiquetas nos animais e conhecemos todas as marcas comerciais usadas no mundo inteiro. Ninguém tinha visto esta etiqueta antes. Aqui está ela, aumentada dez
vezes. O objeto tem o tamanho aproximado de uma unha do polegar. Superfície uniforme de plástico, pregada no animal por meio de um clipe de aço inoxidável forrado
com Teflon no outro lado. É um clipe muito pequeno, do tipo usado para filhotes. O animal que você viu era adulto?
- Supostamente.
- Então a etiqueta provavelmente foi pregada há algum tempo, quando o animal era novo - disse Gelman. - O que faz sentido, considerando o grau de uso que
ela aparenta. Note as picadas na superfície. Não são comuns. Este plástico é Suralon, o material usado para capacetes de futebol americano. É extremamente duro,
e estas picadas não podem ser o resultado apenas do uso.
- De que então?
- Tenho quase certeza de que se trata de uma reação química, como exposição a um ácido, talvez sob a forma de aerossol.
- Como vapor vulcânico? - perguntou Malcolm.
- Pode ser, especialmente tendo em conta o resto que descobrimos. Pode ver que a etiqueta é bastante espessa - na verdade, tem nove milímetros de largura.
E é oca.
- Oca? - perguntou Malcolm, com estranheza.
- Sim, contém uma cavidade interna. Não quisemos abrir, por isso tiramos uma radiografia. Aqui está. - O slide mudou e Malcolm viu um amontoado de linhas
brancas e quadrados dentro da etiqueta.
- Parece ter havido bastante corrosão aqui também devido à ação de vapores ácidos. Mas não há dúvida do que isto era originalmente. E uma etiqueta de rádio,
Ian. O que significa que este animal raro, este lagarto de sangue quente ou seja lá o que for, foi etiquetado e criado por alguém desde o nascimento. E foi isso
que preocupou o pessoal aqui do nosso laboratório. A idéia de alguém criar uma coisa dessas. Você sabe o que aconteceu?
- Não tenho a mínima idéia - disse Malcolm.
Elizabeth Gelman suspirou.
- Você é um filho da mãe mentiroso.
Ele levantou a mão.
- Pode devolver a minha amostra?
- lan - disse ela. - Depois de tudo que fiz por você...
- A amostra.
- Acho que me deve uma explicação.
- E eu prometo que terá. Dentro de duas semanas, mais ou menos. Eu pago o jantar.
Ela jogou um embrulho de papel de alumínio na mesa. Ele o apanhou e guardou no bolso.
- Obrigado, Liz. - Malcolm levantou. - Detesto ter de ir agora, mas preciso dar um telefonema imediatamente.
Ele caminhou para a porta e Elizabeth disse:
- A propósito, como foi que ele morreu, Ian? Esse animal? Malcolm pensou por um momento.
- Por que pergunta?
- Porque, quando deslocamos as células da pele, encontramos algumas células estranhas sob a camada externa da epiderme. Células de outro animal.
- O que significa isso?
- Bem, é um quadro típico de uma luta entre dois lagartos. Esfregam o corpo um no outro e as células penetram a camada superficial da pele.
- Sim - ele disse. - Havia sinais de luta na carcaça. O animal estava ferido.
- E você deve saber que havia sinais de vasoconstrição crônica das artérias. Este animal estava sob grande estresse, Ian. E não apenas por causa da luta
ou do ferimento. Se fosse, teria desaparecido nas primeiras alterações do post-mortem. Estou falando de estresse crônico, contínuo. Onde quer que ele vivesse, o
meio ambiente era extremamente opressivo e perigoso.
- Compreendo.
- Então, como um animal etiquetado podia levar uma vida tão estressante e cheia de perigos?

Na entrada do zoológico ele olhou em volta para ver se estava sendo seguido, depois entrou na cabine telefônica e ligou para Levine. A secretária eletrônica
atendeu. Levine não estava. Típico, pensou Malcolm. Levine nunca está quando precisamos dele. Provavelmente tentando outra vez recuperar a Ferrari confiscada pelo
juiz.
Malcolm desligou e foi para seu carro.

THORNE


Estava escrito "Thorne Mobile Field Systems", com letras pretas numa grande porta sanfonada de garagem, no fim do Parque Industrial. A esquerda havia uma
porta comum. Arby tocou a campainha na pequena caixa com grade. Uma voz irritada disse:
- Vá embora.
- Somos nós, Dr. Thorne. Arby e Kelly.
- Oh, está bem.
Um estalo, a fechadura foi aberta e eles entraram no grande galpão aberto. Homens trabalhavam na modificação de vários veículos, o ar cheirava a acetileno,
óleo de motor e tinta fresca. Logo à frente Kelly viu um Ford Explorer verde-escuro com uma abertura na capota. Dois assistentes no alto de escadas instalavam uma
célula de luz solar na parte aberta do capo do carro. O capo estava aberto e os homens substituíam o motor V-6 por outro menor, que parecia uma caixa de sapatos
revestida de liga de alumínio. Outros assistentes levavam o retângulo largo e plano do conversor Hughes para ser montado sobre o motor.
À direita, Kelly viu dois trailers RV nos quais a equipe de Thorne trabalhava há duas semanas. Não eram iguais aos trailers comuns que as pessoas usam nas
férias. Um era enorme e estreito, quase do tamanho de um ônibus, equipado com sala e quartos para quatro pessoas, além de todo o tipo de equipamento científico.
Era o "Challenger", com uma propriedade especial. Quando estacionado, as paredes podiam ser afastadas para fora, aumentando o espaço interno.
O Challenger podia puxar um trailer menor, ao qual era ligado por uma passagem em forma de sanfona. Esse segundo RV continha equipamento de laboratório e
instrumentos de alta tecnologia, que Kelly não sabia ao certo para que serviam. Naquele momento, o segundo trailer estava quase escondido pelas fagulhas longas do
soldador elétrico. Apesar de toda essa atividade, o trailer parecia quase terminado - mas ela podia ver homens trabalhando dentro dele, e todos os bancos e poltronas
estavam no chão da oficina.
Thorne, de pé no centro do galpão, gritava para o soldador no teto do trailer:
- Vamos, vamos, precisamos terminar hoje, Eddie, vamos com isso. - Voltou-se e gritou outra vez. - Não! Não! Veja o desenho do projeto! Henry, você não pode
encaixar esse reforço lateralmente. Tem de ficar atravessado, para dar mais força. Consulte o projeto!
O Dr. Thorne era um homem grisalho e forte de cinqüenta e cinco anos. A não ser pelos óculos de aros de metal, parecia um boxeador aposentado. Kelly mal podia
imaginar Thorne como um professor universitário. Era um homem enorme, sempre em movimento.
- Que droga, Henry! Henry, está me ouvindo?
Thorne praguejou outra vez e balançou os punhos fechados. Voltou-se para os meninos.
- Esses caras - disse ele - estão aqui supostamente para me ajudar! - Um estalo seco, como de um relâmpago, soou no Explorer. Os dois homens encostados no
capo saltaram para o lado. Uma nuvem de fumaça subiu para o teto. - O que eu disse? - gritou Thorne. - Liguem o fio terra\ Liguem o fio terra antes de fazer qualquer
coisa! Temos altas voltagens aqui, caras! Se não tiverem cuidado, vão ser fritos!
Olhou outra vez para os meninos e balançou a cabeça.
- Eles simplesmente não entendem. Esse DUI é uma defesa e tanto!
- DUI?
- Defesa ursina interna... foi o nome que Levine inventou. O que ele considera uma boa piada - disse Thorne. - Na verdade, eu inventei esse sistema há alguns
anos para os guardas-florestais do parque Yellowstone, onde os ursos costumam arrombar os trailers. Um choque e tanto! Desanima qualquer urso, por maior que seja.
Mas esse tipo de voltagem pode mandar esses homens para o ar. E depois? Sou processado e obrigado a pagar uma indenização. Pela estupidez deles. - Balançou a cabeça.
- Então? Onde está Levine?
- Nós não sabemos - disse Arby.
- Como não sabem? Ele não deu aula hoje?
- Não, ele não apareceu. Thorne praguejou outra vez.
- Bem, preciso dele hoje para as revisões finais, antes do teste de campo. Ele devia voltar hoje.
- Voltar de onde? - perguntou Kelly,
- Oh, de uma das suas pesquisas de campo - disse Thorne.
- Estava muito entusiasmado. Eu preparei o equipamento, emprestei minha mais nova mochila. Tudo do que ele pode precisar não pesa mais de vinte e cinco quilos.
Ele gostou. Partiu na segunda-feira, há quatro dias.
- Para onde?
- Como vou saber? Ele não me disse. E eu desisti de perguntar. Vocês sabem que eles são todos iguais. Todo cientista que conheço é misterioso. Mas não se
pode culpá-los por isso. Eles têm medo de ser roubados ou processados. O mundo moderno! No ano passado preparei o equipamento para uma expedição no Amazonas, todo
à prova d'água - o que é necessário, na floresta tropical
- aparelhos eletrônicos molhados não funcionam -, e o cientista chefe da expedição foi acusado de apropriação indébita de fundos. Por fazer todo o equipamento
à prova d'água! Um burocrata universitário disse que era uma "despesa desnecessária". É como estou dizendo, é loucura. Loucura. Henry, será que não ouve nada do
que eu digo? Ponha esse reforço atravessado*.
Thorne atravessou o galpão, agitando os braços. Os meninos foram atrás.
- Mas agora olhem para isto - disse Thorne. - Há meses estamos modificando os veículos de campo para ele e finalmente terminamos. Ele quer que sejam leves,
eu os fiz leves. Ele quer que sejam resistentes - leves e resistentes, por que não? É simplesmente impossível o que ele quer, mas, com bastante titânio e um composto
de carbono, estamos fazendo o que ele quer. Ele quer sem nada à base de petróleo e sem radiador, e fizemos isso também. Assim, finalmente ele tem o que queria, um
laboratório enorme e extremamente portátil para funcionar onde não existe gasolina nem eletricidade. E agora que está pronto... não acredito. Ele não apareceu mesmo
para dar a aula?
- Não - disse Kelly.
- Então, Levine desapareceu. Que maravilha! Perfeito! E os testes de campo? íamos testar os veículos durante uma semana para deixar tudo no ponto certo.
- Eu sei - disse Kelly. - Conseguimos permissão dos nossos pais e tudo o mais.
- E agora ele não está aqui. - Thorne estava furioso. - Acho que eu devia esperar isso. Esses garotos ricos só fazem o que querem. Um cara como Levine faz
com que a palavra mimado pareça um palavrão.
Uma grande gaiola de metal despencou do teto, aterrissando perto deles. Thorne saltou para o lado.
- Eddie! Que droga! Será que não pode ter cuidado?
- Desculpe, doutor - disse Eddie Carr, no alto da gaiola. - Mas queremos ter certeza de que a armação não vai deformar a mil e duzentos psi. Temos de testar
tudo.
- Tudo bem, Eddie. Mas não faça os testes quando estamos debaixo deles! - Thorne se inclinou para examinar a gaiola circular, feita com barras de liga de
titânio, com dois centímetros de espessura. Verificou que não fora avariada pela queda. E era leve. Thorne a ergueu com uma das mãos. Tinha cerca de um metro e oitenta
de altura e um metro e vinte de diâmetro. Parecia uma enorme gaiola de passarinho com uma porta de dobradiças e uma fechadura pesada.
- Para que serve isso? - perguntou Arby.
- Na verdade - disse Thorne -, isso faz parte daquilo. - Apontou para o outro lado do galpão, onde um homem montava longarinas de alumínio numa estrutura
telescópica. - Uma plataforma de observação, para ser montada no campo. Os andaimes, quando montados, formam uma estrutura rígida, a uns cinco metros de altura,
com um pequeno abrigo na parte superior. Também telescópico.
- Um posto de observação para observar o quê? - quis saber Arby.
- Ele não disse para vocês? - perguntou Thorne.
- Não - respondeu Kelly.
- Não - disse Arby.
- Bem, também não me disse. - Thorne balançou a cabeça. - Tudo o que sei é que ele quer tudo extremamente resistente. Leve e resistente, leve e resistente.
Impossível. - Ele suspirou. - Deus me livre dos acadêmicos.
- Pensei que você fosse um acadêmico - observou Kelly.
- Ex-acadêmico - Thorne explicou secamente. - Agora eu faço coisas. Não fico só falando.

Todos os conhecidos de Thorne concordavam em dizer que a aposentadoria marcara o início do período mais feliz da vida dele. Como professor de engenharia aplicada
e especialista em materiais exóticos, ele sempre demonstrou sua orientação prática e seu amor pelos alunos. Seu curso mais famoso na Stanford, Engenharia Estrutural
101a, era conhecido entre os alunos como "Os Problemas de Thorne", porque Thorne estava sempre incentivando a classe a resolver os problemas de engenharia aplicada
criados por ele. Alguns desses problemas pertenciam ao folclore dos alunos. Havia, por exemplo, o Desastre do Papel Higiênico: Thorne pediu aos alunos que atirassem
uma caixa de papelão cheia de ovos do alto da torre Hoover sem quebrar os ovos. A única coisa que podiam usar para amortecer a queda seriam os tubos de papelão dos
rolos de papel higiênico. A praça ficou cheia de ovos quebrados.
Em outro ano, Thorne pediu aos alunos que construíssem uma cadeira que suportasse o peso de um homem de cem quilos, usando apenas cotonetes e linha. Outra
vez, ele pendurou no teto a folha com os gabaritos do exame final e convidou os alunos a apanhá-la, usando apenas os instrumentos que pudessem fazer com uma caixa
de sapatos de papelão contendo meio quilo de balas e alguns palitos.
Quando não estava dando aula, Thorne freqüentemente depunha nos tribunais como especialista em processos legais que envolviam materiais de engenharia. Ele
se especializou em explosões, acidentes de avião, desmoronamentos de prédios e outros desastres. Essas incursões no mundo real abriram seus olhos para o fato de
que os cientistas deviam adquirir os mais variados conhecimentos. Costumava dizer: "Como podem desenhar plantas se não conhecem história e psicologia? Não podem,
porque suas fórmulas matemáticas podem ser perfeitas, mas as pessoas vão usá-las de modo errado. E, quando isso acontece, significa que vocês erraram." Ele enriquecia
suas aulas com citações de Platão, Chaka Zulu, Emerson e Chang-tsé.
Porém, como professor popular entre os alunos - e que defendia a tese do ensino generalista -, Thorne percebeu que estava remando contra a maré. O mundo acadêmico
marchava para uma especialização cada vez mais extrema, com terminologias cada vez mais densas e limitadas. Nesse ambiente, ser querido pelos alunos era uma leviandade.
O interesse pelos problemas do mundo real era prova de pobreza intelectual e indiferença lamentável para com a teoria. Porém, no fim, foi sua admiração por Chang-tsé
que o fez deixar a universidade. Numa reunião do departamento, um dos seus colegas levantou-se e disse que "Um chinês mítico e cretino significa tudo para a engenharia".
Um mês depois, Thorne resolveu se aposentar antes do tempo e logo depois fundou sua empresa. Aquele trabalho era uma fonte de prazer real para ele, mas sentia
falta do contato com os estudantes. Por isso gostou dos dois jovens assistentes de Levine. Os meninos eram inteligentes, cheios de entusiasmo e jovens demais para
que a escola tivesse destruído toda a sua vontade de aprender. Podiam ainda usar os cérebros, o que, na opinião de Thorne, era um sinal certo de que não haviam concluído
a educação formal.

- Jerry! - berrou Thorne para um dos soldadores no RV. - Equilibre os reforços nos dois lados! Lembre-se dos testes de impacto! - Apontou para um monitor
de vídeo no chão, que mostrava a imagem de computador do RV batendo numa barreira. Primeiro batia de frente, depois de lado, então girava e batia outra vez. Em todas
as vezes o veículo sofria apenas pequenas avarias. O programa de computador fora feito pelos fabricantes de automóveis e depois descartado. Thorne o comprou e modificou.
- É claro que os fabricantes de automóveis o rejeitaram: é uma boa idéia. Eles não querem nenhuma boa idéia saindo de uma grande empresa. Pode levar a um bom produto!
- suspirou. - Usando este computador, já provocamos milhares de batidas com esses veículos, desenhando, batendo, modificando, batendo outra vez. Não teorias, apenas
os testes reais. É assim que deve ser.

O desprezo de Thorne pela teoria era lendário. Para ele, a teoria não passava de um substituto da experiência criado por alguém que não sabia de que estava
falando.
- E agora, escute, Jerry? Jerry! Por que fazer todas essas simulações se vocês não seguem o projeto? Será que todo o mundo aqui perdeu o cérebro?
- Desculpe, doutor...
- Não se desculpe! Faça a coisa certa!
- Bem, de qualquer modo já temos reforço demais...
- E mesmo? Foi o que você decidiu? Você agora é o desenhista do projeto? Apenas siga os planos!
Caminhando ao lado de Thorne, Arby disse:
- Estou preocupado com o Dr. Levine.
- Está mesmo? Pois eu não estou.
- Mas ele sempre foi confiável. E muito organizado.
- Isso é verdade - concordou Thorne. - Também é completamente impulsivo e faz o que lhe dá na cabeça.
- Talvez - disse Arby -, mas não acredito que tenha desaparecido sem um bom motivo. Acho que pode estar em apuros. Na semana passada ele nos levou à Universidade
de Berkeley para visitar o professor Malcolm, que tinha um mapa-múndi no escritório, que mostrava...
- Malcolm! - bufou Thorne. - Por favor, essa não! Aqueles dois são igualzinhos. Cada um com menos espírito prático do que o outro. Mas acho bom eu tentar
falar com Levine agora. - Deu meia-volta e caminhou para o escritório.
Árby perguntou:
- Vai usar o satfone? Thorne parou de andar.
- Um o quê?
- O telefone-satélite - disse Arby. - O Dr. Levine não levou um com ele?
- Como podia? Você sabia que o menor telefone-satélite é do tamanho de uma mala?
- Eu sei, mas não precisa ser - disse Arby. - Você poderia ter feito um muito pequeno.
- Eu poderia? Como? - Thorne parecia estar se divertindo. Era impossível não gostar daquele menino.
- Com aquela placa de computador VLSI que nós fomos buscar - disse Arby. - Aquela triangular. Tinha dois conjuntos de chips Motorola BSN-23, exclusivos da
tecnologia criada pela CIA, porque permitem uma...
- Ei, ei - Thorne interrompeu. - Onde você aprendeu tudo isso? Já avisei que não deve piratear sistemas...
- Não se preocupe, eu tomo cuidado - disse Arby. - Mas é verdade o que eu disse sobre a placa de computador, não é? Pode ser usada para fazer um satfone de
meio quilo. Então, você fez?
Thorne olhou para ele por um longo tempo.
- Talvez - disse, finalmente. - E daí? Arby disse com um largo sorriso:
- Legal.

O pequeno escritório de Thorne ficava num canto do galpão. As paredes, internas eram cheias de plantas e esquemas de projetos, formulários de pedidos em pranchetas
e recortes com desenhos de computador em três dimensões. Sobre a mesa espalhavam-se componentes eletrônicos, catálogos de equipamentos e pilhas de faxes. Thorne
procurou no meio de tudo aquilo e finalmente encontrou um pequeno telefone cinzento.
- Aqui estamos. - Ergueu o aparelho, mostrando-o para Arby. - Muito bom, não é? Eu mesmo projetei.
- Parece um telefone celular - disse Kelly.
- Sim, mas não é. O telefone celular usa uma estação fixa. O telefone satélite conecta-se diretamente com os satélites de comunicação no espaço. Com um destes
podemos falar com qualquer lugar do mundo. - Digitou os números rapidamente. - Antes eles precisavam de uma parabólica de um metro. Depois, de uma de trinta centímetros.
Agora, não precisam de antena nenhuma, só do monofone. Nada mau, se posso dizer assim. Vamos ver se ele responde. - Apertou o botão do bocal. Ouviram o chamado no
meio da estática.
- Conhecendo Richard - disse Thorne -, provavelmente ele perdeu o avião ou esqueceu que precisava estar de volta hoje para os testes finais. E nosso trabalho
está terminado. Chegamos aos reforços e aos bancos internos, e isso quer dizer que terminamos. Ele vai nos atrasar. É uma falta de consideração. - O telefone começou
a tocar com bips contínuos. - Se não conseguir falar com ele, ligo para Sarah Harding.
- Sarah Harding? - perguntou Kelly, erguendo os olhos para ele.
- Quem é Sarah Harding? - perguntou Arby.
- Apenas a mais famosa especialista do mundo em comportamento animal, Arb - disse Kelly.
Sarah Harding era um dos ídolos de Kelly. Tinha lido tudo o que existia sobre ela. Sarah Harding começou como uma bolsista pobre na Universidade de Chicago,
mas agora, com trinta e três anos, era professora assistente em Princeton. Era bonita e independente, uma rebelde que seguiu o próprio caminho. Escolheu a vida de
cientista de campo e morava sozinha na África, onde estudava leões e hienas. E era famosa. Certa vez, quando seu Land Rover enguiçou, ela andou trinta quilômetros
na savana, sozinha, defendendo-se dos leões com pedras.
Nas fotos, Sarah sempre aparecia de short e camisa caqui, com binóculo pendurado no pescoço, ao lado do Land Rover. Com o cabelo escuro e curto e o corpo
forte e musculoso, parecia sólida e charmosa ao mesmo tempo. Pelo menos era assim que Kelly a via, quando estudava as fotos atentamente, notando cada detalhe.
- Nunca ouvi falar nela - disse Arby.
- Tem passado muito tempo com os computadores, Arby?
- Não - ele respondeu. Kelly o viu curvar os ombros para a frente como para se esconder, como fazia sempre que era criticado. Ele resmungou. - Especialista
em comportamento animal?
- Isso mesmo - disse Thorne. - Sei que Levine falou com ela várias vezes nas últimas semanas. Ela o está ajudando com todo esse equipamento, para quando for
levado para o campo. Ou aconselhando. Ou coisa parecida. Ou talvez a conexão seja com Malcolm. Afinal, ela teve um caso com Malcolm.
- Eu não acredito - disse Kelly. - Talvez ele estivesse apaixonado por ela...
Thorne olhou para Kelly.
- Você a conhece?
- Não. Mas sei tudo sobre ela.
- Sei. - Thorne não disse mais nada. Via os sinais da adoração por um herói e aprovava. Não havia nada de mal em admirar Sarah Harding. Afinal, uma menina
podia idolatrar um atleta ou uma estrela do rock. Na verdade, era saudável para uma criança admirar alguém que realmente tentava contribuir para o avanço da ciência...
O telefone continuou a tocar. Sem resposta.
- Bem, sabemos que o equipamento de Levine está em ordem - disse Thorne - porque a ligação está sendo feita. Pelo menos disso nós sabemos.
- Não pode localizar? - perguntou Arby.
- Infelizmente, não. E, se continuarmos, podemos acabar com a bateria de campo, o que significa...
Um estalo, e ouviram uma voz de homem, extremamente clara e distinta.
- Levine.
- Tudo bem. Ótimo. Ele está lá - disse Thorne. Apertou o botão no aparelho. - Richard? E Thorne.
Ouviram o zumbido da estática, depois uma tosse e uma voz rouca disse.
- Alô? Alô? Levine falando.
Thorne apertou outro botão.
- Richard, é Thorne. Está me ouvindo?
- Alô? Alô? - disse Levine. Thorne suspirou.
- Richard. Você tem de apertar o botão T para transmitir. Câmbio.
- Alô? - Outra tosse, profunda e áspera. - Aqui é Levine. Alô?
Thorne balançou a cabeça irritado.
- Estou vendo que ele não sabe manejar o aparelho.Droga! Eu expliquei tudo tão bem! E claro que não estava prestando atenção. Os gênios nunca prestam atenção.
Pensam que sabem tudo. Essas coisas não são brinquedos de criança. - Apertou o botão para transmitir. - Richard, escute. Deve apertar o "F para...
- Aqui fala Levine. Alô? Levine. Por favor, preciso de ajuda. - Algo como um gemido surdo. - Se pode me ouvir, mande ajuda. Escute, estou na ilha, consegui
chegar bem até aqui, mas...
Um estalo. Um assobio.
- Oh-oh - disse Thorne.
- O que é? - perguntou Arby, inclinando-se para a frente.
- Nós o estamos perdendo.
- Por quê?
- Bateria - disse Thorne. - Está acabando rapidamente. Droga. Richard, onde você está?
Ouviram a voz de Levine.
-... já morto... situação ficou... agora... muito séria... não sei... pode me ouvir, mas se você... mande ajuda...
- Richard! Diga onde você está!
O telefone zumbiu, a transmissão ficava cada vez pior. Ouviram Levine dizer:
- ... me cercaram, e... perigosos... sinto o cheiro deles especialmente... noite...
- De que ele está falando? - perguntou Arby.
- ...para... ferimento... não posso... muito tempo... por favor... E então ouviram o zumbido final, desaparecendo aos poucos. De repente, o telefone ficou
mudo.
Thorne desligou o aparelho e o alto-falante de mesa. Os dois meninos estavam pálidos.
- Temos de encontrá-lo - disse Thorne - imediatamente.

SEGUNDA CONFIGURAÇÃO


A auto-organização cresce em complexidade à medida que o sistema avança para o limite caótico.

IAN MALCOLM

AS PISTAS


Thorne abriu com a chave a porta do apartamento de Levine e acendeu as luzes. Pararam atônitos, e Arby disse:
- Parece um museu!
O estilo da decoração do apartamento de dois quartos era levemente asiático, com belos armários de madeira e valiosos objetos antigos. Mas estava imaculadamente
limpo e a maioria das antiguidades protegida por caixas de plástico. Tudo etiquetado. Entraram na sala.
- Ele mora aqui? - perguntou Kelly. Não dava para acreditar. Parecia tão impessoal, quase inumano. O apartamento dela estava quase sempre em desordem...
- E, mora, sim - disse Thorne, guardando a chave no bolso. - Está sempre assim. Por isso Levine não pode morar com uma mulher. Não admite que toquem nas coisas.
Sobre a mesa de centro, rodeada pelos sofás, havia quatro pilhas de livros, cada uma coincidindo perfeitamente com a borda de vidro da mesa. Arby leu os títulos:
Teoria da catástrofe e estruturas emergentes. Processos indutivos na evolução molecular. Autômata celular. Metodologia da adaptação não-linear, Transição de fase
nos sistemas evolutivos. Havia outros com títulos em alemão.
Kelly respirou fundo.
- Tem alguma coisa cozinhando?
- Eu não sei - disse Thorne. Entrou na sala de jantar. No aparador encostado na parede ele viu uma chapa elétrica com uma fileira de pratos cobertos. A mesa
de madeira polida estava posta para uma pessoa, com talheres de prata e copos de cristal lapidado. A fumaça saía de uma terrina com sopa.
Thorne apanhou uma folha de papel que estava sobre a mesa e leu:
- Lagosta bisque, vegetais orgânicos, atum grelhado. - Anexa, uma folha amarela de bloco de recados dizia: "Espero que tenha feito boa viagem! Romelia."
- Nossa -disse Kelly. -Vai me dizer que alguém faz o jantar para ele todos os dias?
- Acho que sim - disse Thorne. Não parecia impressionado. Examinou a pilha de correspondência não-aberta ao lado do prato.
Kelly apanhou alguns faxes na mesa ao lado. O primeiro era do Museu Peabody, em Yale, New Haven.
- Isto é alemão? - ela perguntou, dando o fax para Thorne.

Caro Dr. Levine:
O documento que nos pediu:

Geschichtlich Forschungsarbeiten über die Geologie Zentralameriks, 1922-1929

foi enviado hoje pelo Federal Express.
Obrigado.
(assinado)
Dina Skrumbis, arquivista.
- Não sei alemão - disse Thorne. - Mas acho que é alguma coisa sobre pesquisas em geologia da América Central. E é dos anos vinte, não exatamente uma novidade.
- Para que será que ele queria isto? - disse Kelly. Thorne não respondeu e entrou num dos quartos.

O quarto era simples e quase espartano, a cama um futon preto, perfeitamente arrumada. Thorne abriu as portas dos closets e viu as fileiras de cabides, dispostos
em espaços regulares, toda a roupa passada, grande parte protegida por capas de plástico. Abriu a primeira gaveta da cômoda e viu as meias dobradas, arrumadas por
cores.
- Não sei como ele pode viver assim - disse Kelly.
- Não tem mistério - disse Thorne. - Basta ter empregados. - Abriu as outras gavetas rapidamente, uma depois da outra.
Kelly foi até a mesa-de-cabeceira, onde havia vários livros. O de cima era pequeno e amarelado pelo tempo. Era em alemão: Die Fünf Todesarten. Ela folheou
rapidamente, viu as gravuras coloridas do que pareciam ser trajes astecas de cores vivas. Era quase como um livro infantil ilustrado, pensou.
Debaixo dele estavam livros e artigos de revistas especializadas com a capa escura do Instituto Santa Fé: Algoritmos genéticos e redes heurísticas. Geologia
da América Central, Disposição autômata da dimensão arbitrária. O Relatório Anual de 1989 da empresa InGen. E ao lado do telefone uma folha com anotações escritas
às pressas. Ela reconheceu a letra clara de Levine.
Dizia
"SÍTIO B"
Vulkaniche
Tacaho?
Nublar?
1 de 5 mortes?
nas monta... Não!!
talvez Guitierrez
cuidado.

Kelly perguntou.
- O que é Sítio B? Ele tem umas anotações aqui sobre isso. Thorne foi verificar.
- Vulkanische quer dizer vulcânico, eu acho. E Tacano e Nublar... Parecem nomes de lugares. Se forem, podemos verificar num Atlas...
- E o que é isto sobre cinco mortes? - ela perguntou.
- Não tenho idéia.
Estavam olhando para o papel quando Arby entrou no quarto e perguntou:
- O que é Sítio B?
Thorne virou para ele.
- Por quê?
- Acho melhor vir ver uma coisa no escritório dele.
Levine tinha feito o escritório no segundo quarto. Como o resto do apartamento, estava impecavelmente limpo e em ordem. Os papéis estavam arrumados com precisão
num lado da mesa, perto do computador coberto com uma capa de plástico. Mas, atrás da mesa, um quadro de cortiça cobria quase toda a parede. E nesse quadro Levine
tinha pregado mapas, cartas, recortes de jornais, imagens de satélite e fotografias aéreas. Na parte superior do quadro uma anotação em letras grandes: "Sítio B?"
Ao lado estava uma foto pouco nítida de um chinês de óculos com um jaleco branco de laboratório, na selva, perto de uma tabuleta de madeira que dizia: "Sítio
B". O jaleco estava desabotoado, mostrando a camiseta com alguma coisa escrita.
Ao lado da foto estava uma grande ampliação da camiseta, como aparecia na fotografia original. Quase não dava para ver as letras, parcialmente escondidas
pelos dois lados do jaleco, mas a camiseta parecia dizer:

nGen Sítio B
mplexo pesqui

Levine tinha escrito à mão com letra clara: "InGen Sítio B Complexo de pesquisa??? ONDE???
Logo abaixo viram uma passagem recortada do Relatório Anual da InGen. Um parágrafo dentro de um círculo dizia:

Além da sua sede em Paio Alto, onde a InGen mantém um laboratório de pesquisas ultramoderno com 600 metros quadrados, a empresa possui três laboratórios de
campo no resto do mundo. Um laboratório de geologia na África do Sul, onde são coletados âmbar e outros espécimes geológicos; uma fazenda experimental nas montanhas
da Costa Rica, onde são cultivadas variedades de plantas exóticas, e um complexo na ilha Nublar, duzentos quilômetros a oeste da Costa Rica.

Logo abaixo, Levine escreveu: "Não B! Mentirosos!"
- Ele está mesmo obcecado por esse Sítio B. - disse Arby.
- Tem razão - disse Thorne. - E ele acha que fica numa ilha em algum lugar.
Thorne se aproximou mais do mapa, examinando as imagens de satélite. Notou que, embora estivessem gravadas com cores falsas, com vários graus de ampliação,
todas pareciam mostrar a mesma área geográfica, de um modo geral: uma costa rochosa com algumas ilhas ao largo. A linha da costa tinha uma praia cercada pela selva.
Podia ser da Costa Rica, mas era impossível dizer ao certo. Na verdade, podia ser uma dezena de lugares do mundo.
- Ele disse que estava numa ilha - observou Kelly.
- Sim. - Thorne deu de ombros. - Mas isso não ajuda muito. - Olhou outra vez para o quadro. - Deve haver vinte ilhas aqui, talvez mais.
Viu um memorando na parte inferior do quadro.

SÍTIO B@#$#PARATODOS OS DEPARTAMENTOS DEQ **** AOS CUIDADOS DE%$#@#!PRESS AVOIDAN******
Sr. Hammond quer lembrar a todos ****depois/v*&Amercado *%*** Plano de mercado a longo prazo*&A&A%
Mercado dos complexos propostos exige que a completa complexidade da tecnologia de JP não seja revelada anunciada seja conhecida. O Sr. Hammond quer lembrar a todos
os departamentos que o complexo de Produção não será tópico assunto de qualquer informação à imprensa ou discussão em qualquer tempo.
O complexo de produção/fabricação não pode ser#@#$# referência ao local da ilha de produção Islã S. apenas referência interna estritas diretrizes de imprensa ****%$**

- Isto é estranho - disse ele. - O que vocês acham?
Arby olhou pensativamente para o memorando.
- Todas as letras que faltam são lixo - disse Thorne. - Faz algum sentido para você?
- Faz - disse Arby. Estalou os dedos e foi para a mesa de Levine. Tirou a capa de plástico do computador e disse: - Foi o que pensei.
O computador na mesa de Levine não era tão moderno como Thorne teria esperado. Era grande e pesado, com a parte externa arranhada em vários lugares. Uma fita
adesiva preta dizia: "Design Associates, Inc." E mais abaixo, ao lado do botão de força, uma pequena placa de metal dizia: "Propriedade da International Genetics
Technology, Inc., Paio Alto, CA."
- O que é isso? - perguntou Thorne. - Levine tem um computador da InGen?
- Sim - disse Arby. - Apanhamos para ele na semana passada. Estavam vendendo equipamento para computador.
- E ele mandou vocês?
- Isso mesmo. Eu e Kelly. Ele não. queria ir pessoalmente. Tem medo de estar sendo seguido.
- Mas esta coisa é um CAD-CAM e deve ter uns cinco anos - disse Thorne. - Os computadores CAD-CAM eram usados por arquitetos, artistas gráficos e engenheiros
mecânicos. Para que Levine ia querer isso?
- Ele não disse. - Arby ligou o computador. - Mas agora eu sei.
- Sabe?
- Aquele memorando. - Arby indicou o quadro com a cabeça. - Sabe por que está daquele jeito? E um arquivo de computador recuperado. Levine está recuperando
os arquivos da InGen desta máquina.

Como Arby explicou, todos os computadores vendidos pela InGen naquele dia tinham os drives reformatados para destruir qualquer dado sensível dos discos. Mas
os computadores CAD-CAM eram uma exceção. Todos tinham um software especial instalado pelo fabricante. O software era projetado para funcionar com computadores individuais,
usando códigos de referência individuais. Isso fazia com que fosse difícil reformatar, porque teriam de reinstalar o software individualmente e isso levaria horas.
- Então, eles não reformataram - disse Thorne.
- Certo - concordou Arby. - Apenas apagaram o diretório e venderam os computadores.
- Isso quer dizer que os arquivos originais estão ainda no disco.
- Certo.
O monitor acendeu. A tela dizia:

ARQUIVOS TOTALMENTE RECUPERADOS: 2.387.

- Nossa! - Arby inclinou-se para a frente olhando com atenção, os dedos nas teclas. Digitou a tecla para diretório e fileira após fileira de nomes de arquivos
passaram na tela. Milhares de . arquivos ao todo.
Thorne perguntou.
- Como você vai...
- Me dê um minuto - interrompeu Arby, e começou a digitar rapidamente.
- Tudo bem, Arby - disse Thorne. Ele achava graça na atitude imperiosa de Arby sempre que usava um computador. Parecia esquecer que era apenas um menino
e toda a sua timidez desaparecia. O mundo eletrônico era seu elemento. E Arby sabia que era muito bom nisso.
Thorne disse:
- Qualquer ajuda que possa nos dar será...
- Dr. Thorne - disse Arby. - Escute. Vá... bem, eu não sei. Vá ajudar Kelly, ou coisa assim.
E voltou para o teclado.

RAPTOR


O velocirraptor tinha um metro e oitenta e cinco de altura e era verde-escuro. Em posição de ataque, ele emitia um silvo estridente, o pescoço musculoso estendido
para a frente, a boca aberta. Tim, um dos modeladores, disse:
- O que acha, Dr. Malcolm?
- Não é uma ameaça - disse Malcolm. Estava passando por uma das alas do departamento de biologia, a caminho do seu escritório.
- Não é uma ameaça? - perguntou Tim.
- Ele nunca fica nessa posição, apoiado nos dois pés. Dê um livro para ele - apanhou um caderno de anotações da mesa e pôs nos braços do animal - e ele poderia
cantar uma canção de Natal.
- Puxa - disse Tim. - Não pensei que estivesse tão ruim.
- Ruim? - disse Malcolm - Isto é um insulto a um grande predador. Devíamos sentir sua velocidade, ameaça e força. Abra mais as mandíbulas. Abaixe o pescoço.
Enrijeça os músculos, estique a pele. E levante esta perna. Lembre, os raptores não atacam com a boca - eles usam as garras dos pés. Quero ver aquela garra levantada,
pronta para descer e rasgar os intestinos da presa.
- Acha mesmo? - Tim não parecia muito convencido. - Pode assustar as crianças...
- Quer dizer, pode assustar você. - Malcolm continuou seu caminho. - E outra coisa: mude esse som sibilante. Parece alguém urinando. Dê um rosnado para o
animal. Dê ao grande predador aquilo a que ele tem direito.
- Nossa - disse Tim. - Eu não sabia que tinha sentimentos tão pessoais em relação a isso.
- Deve ser exato - disse Malcolm. - Você sabe, existe uma coisa chamada exatidão e outra chamada inexatidão. Independente de quais sejam os seus sentimentos
- continuou a andar, irritado, ignorando a dor na perna. O modelador o aborrecia, embora tivesse de admitir que Tim era apenas um representante da corrente de pensamento
confuso - o que Malcolm chamava de "ciência sentimentalóide".
Há muito tempo Malcolm se impacientava com a arrogância dos seus colegas cientistas. Eles mantinham aquela arrogância, ele sabia, ignorando definitivamente
a história da ciência como uma forma de pensamento. Os cientistas diziam que a história não tinha importância porque os erros do passado estavam sendo corrigidos
pelas descobertas modernas. Mas é claro que seus antepassados também pensavam assim. Estavam errados no seu tempo. E os cientistas modernos estavam errados agora.
Nenhum episódio da história da ciência comprovava isso de modo mais claro do que o modo pelo qual os dinossauros tinham sido representados através das décadas.
Era importante saber que a percepção mais exata dos dinossauros foi a primeira. Na década de 1840, quando Richard Owen descreveu pela primeira vez ossos gigantes
na Inglaterra, ele os chamou de Dinosauria: lagartos terríveis. Esta era ainda a mais exata definição dessas criaturas, pensava Malcolm. Eram realmente como lagartos
e eram terríveis.
Mas, depois de Owen, a visão "científica" sobre os dinossauros sofreu várias mudanças. Porque os vitorianos acreditavam na inevitabilidade do progresso, insistiam
em dizer que os dinossauros deviam ser necessariamente inferiores - do contrário, por que estavam extintos? Assim os vitorianos os fizeram gordos, letárgicos e burros
- grandes idiotas do passado. Essa percepção foi elaborada de tal modo que no começo do século XX os dinossauros tornaram-se tão fracos que mal podiam suportar o
próprio peso. Os apatossauros tinham de ficar o tempo todo com a barriga mergulhada na água para não amassar as próprias pernas. Toda a concepção do mundo antigo
sofre a influência dessas idéias acerca de animais fracos, burros e lerdos.

Essa descrição só foi mudada na década de 1960, quando alguns cientistas renegados, liderados por John Ostrom, começaram a imaginar dinossauros ágeis, rápidos,
de sangue quente. Como esses cientistas tiveram a ousadia de questionar o dogma, foram brutalmente criticados durante anos, muito embora tudo parecesse indicar que
sua idéia estava certa.
Porém, na última década, um maior interesse pelo comportamento social levou a outra concepção. Os dinossauros passaram a ser vistos como criaturas amorosas,
que viviam em grupos e criavam seus filhotes. Eram bons animais, até mesmo engraçadinhos. Os grandes e doces animais nada tinham a ver com o destino terrível que
os acometeu na forma do meteoro de Alvarez. E essa nova concepção sentimentalóide produziu gente como Tim, que não queria ver a outra face da vida. É claro que alguns
dinossauros eram sociais e cooperativos. Mas outros eram caçadores - e matadores de uma crueldade sem igual. Para Malcolm, o verdadeiro quadro da vida no passado
incorporava a interação de todos os aspectos da vida, o bom e o mau, o forte e o fraco. Não adiantava pretender qualquer outra coisa.
Assustar as crianças, essa era muito boa! Andando no corredor, Malcolm bufou, irritado.
Na verdade, Malcolm estava preocupado com o que Elizabeth Gelman havia dito sobre o fragmento de tecido e especialmente sobre a etiqueta. Malcolm tinha certeza
de que a etiqueta ia causar problemas.
Mas não sabia o que fazer a respeito.
Virou na esquina, passou por uma exposição de flechas feitas pelos homens primitivos da América. Na ante-sala do seu escritório, Beverly, sua assistente,
arrumava os papéis sobre a mesa, preparando-se para ir para casa. Entregou a ele os faxes do dia e disse:
- Deixei uma mensagem para o Dr. Levine no escritório dele, mas ele não telefonou. Ao que parece, não sabem onde ele está.
- Para variar. - Malcolm suspirou. Era difícil trabalhar com Levine, ele era imprevisível demais, nunca se podia saber o que esperar. Foi Malcolm quem pagou
a fiança quando Levine foi detido na sua Ferrari. Examinou os faxes. Datas de conferências, pedidos de cópias... nada interessante. - Tudo bem, Beverly, obrigado.
- Ah. Os fotógrafos estiveram aqui. Eles terminaram há uma hora mais ou menos.
- Que fotógrafos?
- Do Chãos Quarterly. Vieram fotografar seu escritório.
- Do que você está falando? - perguntou Malcolm.
- Eles vieram fotografar seu escritório - ela repetiu. - Para uma série sobre os locais de trabalho de matemáticos famosos. Tinham uma carta sua, dizendo
que era...
- Eu não escrevi carta nenhuma - disse Malcolm. - E nunca ouvi falar de Chãos Quarterly.
Malcolm entrou no escritório e olhou em volta. Beverly foi atrás dele, preocupada.
- Está em ordem? Está tudo aí?
- Sim - disse ele, fazendo um exame rápido. - Parece que está em ordem. Começou a abrir as gavetas da mesa. Não parecia faltar nada.
- E um alívio - disse Beverly - porque... Malcolm olhou para a outra extremidade da sala. O mapa.
Malcolm tinha um mapa-múndi com alfinetes marcando todos os lugares em que haviam aparecido o que Levine insistia em chamar de "formas aberrantes". Numa estimativa
otimista - a de Levine -, eram doze ao todo, de Rangiroa, no oeste, até o sul da Califórnia e o Equador, no leste. Poucas eram confirmadas. Mas agora havia a amostra
de tecido que confirmava um espécime, o que fazia as outras parecerem mais plausíveis.
- Eles fotografaram este mapa?
- Sim. Fotografaram tudo. Tem importância?
Malcolm olhou para o mapa, tentando ver com os olhos de um estranho, imaginando se seria fácil interpretar aquelas marcas. Ele e Levine haviam passado horas
na frente do mapa, considerando as possibilidades de um "mundo perdido", tentando descobrir onde elo poderia estar. Tinham limitado a área possível a cinco ilhas
de uma série, ao largo do litoral da Costa Rica. Levine estava convencido de que era uma daquelas cinco ilhas, e Malcolm começava a pensar que ele estava certo.
Mas aquelas ilhas não estavam destacadas no mapa...
- Era um grupo muito amável - disse Beverly.- Muito delicado. Estrangeiros... Suíços, eu acho.
Malcolm balançou a cabeça e suspirou. Para o diabo com tudo aquilo, pensou ele. Mais cedo ou mais tarde alguém ia saber.
- Está tudo bem, Beverly.
- Tem certeza?
- Sim, está tudo bem. Tenha uma boa noite.
- Boa noite, Dr. Malcolm.
Sozinho no escritório, ele ligou para Levine. O telefone tocou, e a secretária eletrônica atendeu. Levine ainda não estava em casa.
- Richard, você está aí? Se estiver, atenda, é importante. Esperou. Não aconteceu nada.
- Richard, é o Ian. Escute, temos um problema. O mapa já não é seguro. Mandei analisar aquela amostra, Richard, e acho que ela nos diz onde fica o Sítio B,
se a minha...
Um clique e alguém apanhou o fone. Malcolm ouviu a respiração no outro lado da linha.
- Richard? - perguntou.
- Não - disse a voz. - Aqui é Thorne. E acho melhor você vir para cá imediatamente.

AS CINCO MORTES


- Eu sabia - Malcolm disse, quando chegou ao apartamento de Levine e olhou rapidamente em volta. - Eu sabia que ele ia fazer alguma coisa desse tipo. Você
sabe como Levine é impetuoso. Eu disse a ele, não vá antes de termos toda a informação. Mas eu devia saber. É claro que ele foi.
- Sim, ele foi.
- Ego - Malcolm disse, balançando a cabeça. - Richard tem de ser o primeiro. Tem de descobrir primeiro, tem de chegar primeiro. Estou muito preocupado, ele
pode estragar tudo. Esse comportamento impulsivo, você sabe, é uma tempestade no cérebro, neurônios no limite do caos. A obsessão não passa de uma variação do vício.
Mas qual o cientista que já teve autocontrole? Eles aprendem isso na escola, não é bonito ser equilibrado. Esquecem que Neils Bohr não foi só um grande físico, mas
também um atleta olímpico. Hoje em dia todos eles tentam ser "obsessivos". É o estilo profissional.
Thorne olhou pensativamente para Malcolm, pensando que talvez estivesse percebendo uma ponta de ressentimento competitivo.
- Você sabe para que ilha ele foi? - perguntou.
- Não, eu não sei. - Malcolm andava pelo apartamento, examinando tudo. - Na última vez em que conversamos, limitamos as possibilidades a cinco ilhas, todas
no sul. Mas não tínhamos resolvido ainda qual delas.
Thorne apontou para as imagens do satélite no quadro de cortiça.
- Estas ilhas aqui?
- Sim - disse Malcolm, olhando rapidamente. - Elas formam um arco, todas a cerca de dezesseis quilômetros da costa, na altura da baía de Puerto Cortês. São
supostamente desertas. O povo local as chama de as Cinco Mortes.
- Por quê? - perguntou Kelly.
- Uma antiga lenda indígena - disse Malcolm. - Algo sobre um bravo guerreiro capturado por um rei que ofereceu a ele a escolha entre cinco tipos de morte.
Ser queimado, afogado, amassado, enforcado, decapitado. O guerreiro disse que ficava com todas e foi de ilha em ilha, experimentando os vários desafios. Uma espécie
de versão do Novo Mundo das vicissitudes de Hércules.
- Então é isso! - disse Kelly, e saiu correndo da sala. Malcolm não entendeu.
Virou para Thorne, que deu de ombros. Kelly voltou com o volume que parecia um livro infantil em alemão e o entregou para Malcolm.
- Sim - disse ele. - Die Fünf Todesarten. As cinco formas da Morte. É interessante que seja em alemão...
- Ele tem uma porção de livros em alemão - disse Kelly. - Tem mesmo? O filho da mãe. Ele nunca me disse.
- Significa alguma coisa? - perguntou Kelly.
- Significa muita coisa. Dê-me aquela lente de aumento, por favor.
Kelly apanhou a lente da mesa e entregou a ele.
- O que significa?
- As Cinco Mortes são antigas ilhas vulcânicas - disse
Malcolm. - O que quer dizer que são geologicamente muito ricas. Na década de 1920, os alemães queriam explorar a mineração nas ilhas. - Examinou as imagens
com a lente. - Ah, sim, essas são as ilhas, não há dúvida. Matanceros, Muerte, Tacano, Sorna, Pena... Todos nomes de morte e destruição... Muito bem. Acho que estamos
perto. Temos alguma imagem de satélite com análise espectográfica da camada de nuvem?
- Isso vai nos ajudar a encontrar o Sítio B?
- O quê? - Malcolm girou o corpo rapidamente e olhou para ele. - O que você sabe sobre o Sítio B?

Arby estava sentado na frente do computador, trabalhando ainda.
- Nada. Apenas que o Dr. Levine estava procurando o Sítio B. E era o nome que estava nos arquivos.
- Que arquivos?
- Eu descobri alguns arquivos da InGen neste computador. E procurando entre os antigos registros, encontrei referências ao Sítio B... Mas são bastante confusas.
Como esta. - Inclinou para trás na cadeira para que Malcolm pudesse ver a tela.

Resumo: Revisões do Plano #35
_______________________________________________________________
PRODUÇÃO (SÍTIO B)
OPERADORES DE AR Grau 5 a Grau 7
ESTRUTURA DO LAB. 400cm a 510cm
BIOSSEGURANÇA Nível PK/3 a Nível PK/5
VELOCIDADE DA CORREIA
TRANSPORTADORA 3 mpm a 2,5 mpm
JAULAS 13 hectares 26 a hectares
EQUIPE Q 17(4 admi) a 19 (4admi)
PROTOCOLO COM ET(VX) a RDT(VX)

Malcolm franziu a testa.
- Curioso, mas não ajuda muito. Não nos diz qual é a ilha, nem mesmo se é uma ilha.
- Bem - Arby digitou algumas teclas. - Vejamos. Olhe isto.

SÍTIO B REDE DA ILHA PONTOS NODAIS
________________________________________________________________
ZONA 1 (RIO) 1 - 8
ZONA 2 (COSTA) 9 -16
ZONA 3 (CORDILHEIRA) 17 - 24
ZONA 4 (VALE) 25 - 32

- Tudo bem, então é uma ilha. E o Sítio B tem uma rede, mas uma rede de quê? Computadores? - perguntou Malcolm.
- Eu não sei. Talvez de rádio - respondeu Arby.
- Para quê? Qual a utilidade de uma rede de rádio? Isto não ajuda muito.
Arby deu de ombros, tomando aquilo como um desafio. Começou a digitar furiosamente outra vez. Então disse:
- Espere!... Aqui está outro... se eu conseguir formatar... Pronto! Consegui!
Afastou-se da tela para que os outros pudessem ver. Malcolm olhou e disse.
- Muito bom. Muito bom!

SÍTIO B - LEGENDAS

ALA LESTE ALA OESTE ÁREA DE CARGA
LABORATÓRIO ÁREA DE MONTAGEM ENTRADA
PLANO GERAL ÁREA CENTRAL GEOTURBINA
LOJA DE CONVENIÊNCIA VILA DOS TRABALHADORES GEOCENTRO
POSTO DE GASOLINA PISCINA/TÊNIS CAMPO DE GOLFE
CASA DO ADMINISTRADOR PISTA DE CORRIDA TUBULAÇÃO DE GÁS
SEGURANÇA UM SEGURANÇA DOIS CONDUTORES TÉRMICOS
DOCA FLUVIAL CASA DE BARCOS SOLAR UM
ESTRADA DO PÂNTANO ESTRADA DO RIO ESTRADA DA CORDILHEIRA
ESTRADA DA MONTANHA ESTRADA DO PENHASCO JAULAS

- Agora estamos chegando a algum lugar - disse Malcolm, examinando a lista. - Pode imprimir isto?
- Claro - disse Arby, com um sorriso satisfeito. - É mesmo bom?
- É mesmo bom - disse Malcolm. Kelly olhou para Arby e disse:
- Arb, estas são as legendas do mapa.
- Sim, acho que sim. Legal, não é mesmo? - Apertou a tecla para imprimir.
Malcolm examinou a lista outra vez, depois voltou para os mapas do satélite, olhando atentamente para cada um com a lente de aumento e o nariz a poucos centímetros
das fotos.
- Arb - disse Kelly -, não fique aí sentado. Vamos! Recupere o mapa! É o que precisamos!
- Não sei se posso - disse Arby. - É um formato que implica trinta e dois bits... Quero dizer, é um grande trabalho.
- Pare de choramingar, Arb, e faça.
- Não precisa - disse Malcolm, afastando-se das fotos de satélite. - Não é importante.
- Não é? - perguntou Arby, um pouco ofendido.
- Não, Arby. Pode parar. Porque, com o que já descobrimos, tenho certeza de que posso identificar a ilha agora mesmo.

JAMES


Ed James bocejou e apertou mais o fone contra a orelha. Queria ter certeza de ouvir tudo. Procurou uma posição mais confortável no banco do seu Taurus cinzento,
tentando ao mesmo tempo continuar acordado. O pequeno gravador girava no seu colo, ao lado do bloco de anotações e das embalagens amassadas de dois Big Macs. James
olhou para o prédio de Levine, no outro lado da rua. As luzes estavam acesas no apartamento do terceiro andar.
E o grampo que ele havia instalado estava funcionando com perfeição. Ouviu um dos meninos dizer:
- Como?
E então o cara aleijado, Malcolm, disse:
- A essência da verificação é a convergência das várias linhas de raciocínio para um mesmo ponto.
- O que quer dizer isso? - perguntou o menino.
- Veja essas fotos do Landsat.
James escreveu LANDSAT no bloco de anotações.
- Já olhamos para elas - disse a menina.
James pensou na tolice de não ter percebido antes que os dois meninos estavam trabalhando para Levine. Lembrava bem deles. Estavam na classe em que Levine
lecionava. Um garoto pequeno e negro e uma menina branca desajeitada. Apenas crianças de onze ou doze anos. Ele devia ter adivinhado.
Não que fosse importante agora, pensou. Estava conseguindo a informação. Estendeu a mão para a parte superior do painel, apanhou as últimas duas batatas fritas
e comeu, embora estivessem frias.
- Tudo bem - ouviu Malcolm dizer, - É esta ilha aqui. Levine foi para esta ilha.
A menina parecia duvidar.
- Acha mesmo? Esta é... a Islã Sorna.
James escreveu ISLÃ SORNA.
- Esta é a nossa ilha - disse Malcolm. - Por quê? Três motivos diferentes. O primeiro, é uma ilha particular, portanto não foi completamente revistada pelo
governo da Costa Rica. Segundo, a quem pertence? Aos alemães, que nos anos vinte conseguiram o leasing da ilha para mineração.
- Todos aqueles livros em alemão?
- Exatamente. Terceiro, pelo que vimos na lista de Arby, e em outra fonte independente, está claro que existe gás vulcânico no Sítio B. Assim, qual a ilha
que tem gás vulcânico? Apanhe a lente de aumento e verifique você mesma. Acontece que só uma ilha tem esse tipo de gás.
- Quer dizer esta aqui? - perguntou a menina.
- Certo. Isso é fumaça vulcânica.
- Como sabe?
- Análise espectrográfica. Está vendo esta coluna aqui? E enxofre na camada de nuvem. Na verdade, as únicas fontes de enxofre são as fontes vulcânicas.
- Isso também é vulcânico? - perguntou Thorne.
- Pode ser. A atividade vulcânica desprende metano, mas geralmente durante as erupções. A outra possibilidade é ser material orgânico.
- Orgânico? O que quer dizer?
- Grandes herbívoros e...
Depois eles disseram alguma coisa que James não ouviu e em seguida ouviu a voz do menino.
- Quer que eu termine esta recuperação ou não? - Ele parecia aborrecido.
- Não - disse Thorne. - Pode deixar, Arby. Sabemos o que lemos de fazer. Vamos, meninos!
James olhou para o apartamento e viu as luzes serem apagadas. Alguns minutos depois, Thorne e os meninos apareceram na porta em frente do prédio. Entraram
no jipe e foram embora. Malcolm foi para seu carro, entrou com alguma dificuldade e saiu na direção oposta.
James pensou em seguir Malcolm, mas tinha outra coisa a fazer. Ligou o motor, apanhou o telefone e discou um número.

SISTEMAS DE CAMPO


Meia hora mais tarde, outra vez no escritório de Thorne, Kelly olhou em volta, atônita. Quase todos os trabalhadores já haviam saído, e o galpão estava limpo
e em ordem. Os dois trailers e o Explorer estavam lado a lado, pintados de verde-escuro e prontos para partir.
- Eles terminaram!
- Eu disse que iam terminar - disse Thorne. Voltou-se para seu capataz, Eddie Carr, um jovem forte de vinte e poucos anos. - Eddie, onde estamos?
- Prontos para a viagem, Thorne - Eddie disse. - A tinta ainda não secou em alguns lugares, mas estará seca de manhã.
- Não podemos esperar até amanhã. Vamos partir agora.
- Vamos?
Arby e Kelly trocaram um olhar. Era novidade para eles, também.
- Preciso de você para dirigir um destes, Eddie - disse Thorne - Precisamos estar no aeroporto à meia-noite.
- Mas pensei que fôssemos fazer os testes de campo...
- Não há tempo para isso. Vamos direto para o local. - Tocaram a campainha. - Provavelmente é Malcolm. - Apertou o botão para abrir a porta.
- Não vai fazer o teste de campo? - perguntou Eddie, preocupado. - Acho melhor verificar o funcionamento deles, Thorne. Fizemos algumas modificações bastante
complexas e...
- Não temos tempo - disse Malcolm, entrando. - Temos de partir imediatamente. - Voltou-se para Thorne. - Estou muito preocupado com ele.
Eddie, os documentos já chegaram? - perguntou Thorne.
- Ah, claro, estão aqui desde a semana passada.
- Muito bem, vá apanhá-los e telefone para Jenkins. Diga que nos encontre no aeroporto e trate dos detalhes. Quero partir dentro de quatro horas.
- Nossa, Thorne...
- Faça o que eu disse.
- Vocês vão à Costa Rica? - perguntou Kelly.
- Isso mesmo. Temos de tirar Levine de lá. Se não for tarde demais.
- Nós vamos também - disse Kelly.
- Isso mesmo - disse Arby. - Nós vamos.
- De jeito nenhum - disse Thorne. - Fora de cogitação.
- Mas nós merecemos!
- O Dr. Levine falou com nossos pais!
- Já temos permissão!
- Vocês têm permissão - Thorne disse severamente - para um teste de campo no bosque a duzentos quilômetros daqui. Mas não é para lá que nós vamos. Vamos a
um lugar que pode ser muito perigoso e vocês não vão conosco. Ponto final.
- Mas...
- Meninos - disse Thorne. - Não me façam perder a paciência. Vou dar um telefonema. Apanhem suas coisas. Vocês vão para casa.
Ele deu as costas e foi para o telefone.
- Puxa - disse Kelly.
Arby mostrou a língua para as costas de Thorne e resmungou:
- Grande babaca.
- Continue com o programa, Arby - Thorne disse, sem olhar para trás. - Vocês dois vão para casa. Sem discussão.
Entrou no escritório e bateu a porta. Arby enfiou as mãos nos bolsos.
- Eles não teriam descoberto nada sem a nossa ajuda.
- Eu sei, Arb - disse Kelly. - Mas não podemos obrigá-los a nos levar.
Voltaram-se para Malcolm.
- Dr. Malcolm, poderia por favor...

- Desculpe - disse Malcolm. - Não posso.
- Mas...
- A resposta é não, garotos. É perigoso demais.
Desapontados, eles caminharam lentamente para os veículos que brilhavam, refletindo a luz do teto. O Explorer com os painéis fotovoltaicos escuros na capota
e no capo, o interior repleto de equipamento eletrônico novo em folha. Só de olhar para o Explorer dava uma sensação de aventura - uma aventura na qual não tomariam
parte.
Arby espiou para dentro do trailer maior, encostando o rosto no vidro e protegendo os olhos com as mãos em concha nos lados do rosto.
- Caramba! Veja isto!
- Eu vou entrar - Kelly disse, abrindo a porta, por um momento surpresa com a solidez e o peso do metal. Então ela subiu os degraus para o trailer.
O interior era cinza e repleto de equipamento eletrônico. Era dividido em duas seções para as diferentes funções do laboratório. A área principal era um laboratório
de biologia, com bandejas para espécimes, placas para dissecação e microscópios ligados a monitores de vídeo. O laboratório incluía também equipamento bioquímico,
espectrômetro e uma série de analisadores de amostras automatizados. Ao lado ficava a ampla seção do computador, um banco de processadores e uma seção de comunicações.
Todo o equipamento do laboratório era miniaturizado e embutido em pequenas mesas que deslizavam para dentro da parede e podiam ser fechadas a chave.
- É demais - disse Arby.
Kelly não respondeu. Examinava atentamente o laboratório. O doutor Levine tinha projetado aquele trailer aparentemente com um objetivo específico. Não havia
espaço para geologia, botânica ou química, nem muitas outras coisas que uma equipe de campo devia estudar. Não era um laboratório científico geral. Na verdade, parecia
mais uma unidade de biologia e uma grande unidade de computador.
Biologia e computadores.
Ponto final.
Aquele trailer fora construído para estudar o quê?
Numa das paredes havia uma pequena estante de livros, os livros presos com uma fita de Velcro. Ela leu os títulos: Modelos de adaptação dos sistemas biológicos,
Dinâmica comportamental dos vertebrados, Adaptação de sistemas naturais e artificiais, Dinossauros da América do Norte, pré-adaptação e evolução... Parecia uma coleção
estranha para levar numa expedição na selva. Se havia alguma lógica, ela não via.
Continuou a inspeção. Nas paredes notavam-se a intervalos os reforços adaptados ao trailer; listras escuras de composto de carbono. Thorne tinha dito que
era o material usado nos aviões supersônicos de combate. Muito leve e muito resistente. Notou também que os vidros das janelas eram todos de material especial com
uma fina grade de arame por dentro.
Por que o trailer era tão reforçado?
Era um pouco inquietante e Kelly lembrou as palavras do Dr. Levine no telefone. Ele disse que estava cercado.
Cercado de quê?
Ele tinha dito: Sinto o cheiro deles, especialmente à noite.
A que estava se referindo?
Quem eram eles?
Ainda preocupada, Kelly foi para a parte de trás do trailer, onde ficava a pequena área social, com cortinas de algodão nas janelas. Cozinha compacta, um
banheiro e quatro camas. Compartimentos para guardados acima e debaixo das camas. Tinha até um chuveiro. Era bonito.
Kelly entrou na passagem sanfonada que ligava os dois trailers. Era mais ou menos como a passagem entre dois vagões de trem, muito curta. Entrou no segundo
trailer, que parecia servir mais para armazenagem de material. Pneus sobressalentes, autopeças, mais equipamento de laboratório, prateleiras e armários. Todo o suprimento
que indicava uma expedição a algum lugar distante. Tentou abrir alguns armários mas estavam fechados a chave.
Mas ali também havia as placas de reforço. Aquela seção era também excepcionalmente reforçada.
Por quê?, pensou ela. Por que tão reforçada?
- Veja isto - disse Arby, ao lado de uma das paredes. Era um complexo de LEDs brilhantes e uma porção de botões. Para Kelly parecia um termostato muito complicado.
- Para que serve? - ela perguntou.
- Para monitorar o trailer inteiro. Daqui pode-se fazer qualquer coisa. Todos os sistemas, todo o equipamento. E veja isto, uma TV... - Apertou um botão e
o monitor acendeu. Viram Eddie caminhando para eles, fora do trailer.
- Ei, o que é isto? - exclamou Arby. Na parte inferior do LED havia um botão com capa de segurança. Ele abriu a capa. O botão era prateado e dizia DEF.
- Ei, aposto que é aquela defesa contra ursos de que ele falou. Logo depois Eddie abriu a porta e disse.
- Acho melhor parar com isso. Vai descarregar as baterias. Venham, ouviram o que o Thorne disse. Está na hora de ir para casa.
Kelly e Arby trocaram um olhar.
- Tudo bem - disse Kelly. - Estamos indo. Relutantes, saíram do trailer.
Foram para o escritório de Thorne para se despedir. Arby disse:
- Eu gostaria que nos deixasse ir também.
- Eu também.
- Não quero ficar em casa nos feriados -disse ele. - Eles vão trabalhar o tempo todo do mesmo jeito. - Referia-se aos pais.
- Eu sei.
Kelly também não queria ir para casa. A idéia dos testes de campo durante os feriados era perfeita para ela porque significava ficar fora de casa e longe
de uma situação desagradável. Sua mãe trabalhava para uma empresa de seguros como processadora de dados durante o dia e à noite era garçonete no Denny's. Desse modo,
estava sempre trabalhando, e seu mais recente namorado, Phil, costumava passar muito tempo na casa delas, à noite. Tudo estava bem quando Emily, sua irmã, estava
em casa, mas agora ela estava estudando enfermagem no colégio da comunidade e Kelly ficava sozinha. E Phil era meio sinistro. Mas sua mãe gostava dele e não queria
ouvir nenhuma queixa. Ela sempre dizia para Kelly tratar de crescer.
Agora estava indo ao escritório de Thorne com a esperança impossível de que ele cedesse no último momento. Ele estava falando ao telefone, de costas para
eles. Na tela do computador estavam as imagens de satélite que haviam levado do apartamento de Levine. Thorne estava trabalhando nas imagens, fazendo ampliações
sucessivas. Eles bateram à porta e a abriram um pouco.
- Até logo, Dr. Thorne.
- A gente se vê, Dr. Thorne.
Thorne voltou-se, segurando o fone com uma das mãos.
- Até logo, meninos. - Acenou rapidamente com a outra mão.
Kelly hesitou. j - Escute, será que podemos falar um minuto sobre... Thorne balançou a cabeça.
- Não.
- Mas...
- Não, Kelly. Agora, tenho de dar este telefonema. Já são quase quatro horas da manhã na África e daqui a pouco ela vai dormir.
- Quem?
- Sarah Harding.
- Sarah Harding vai também? - Kelly perguntou, da porta.
- Eu não sei. - Thorne deu de ombros. - Tenham um bom feriado, meninos. Vejo vocês daqui a uma semana. Obrigado pela ajuda. Agora, sumam daqui. - Olhou para
o galpão. - Eddie, os meninos estão saindo. Mostre a porta para eles e, quando saírem, tranque por dentro! Apanhe os documentos! E faça sua mala, você vai comigo!
- Então, mudando o tom de voz, disse: - Sim, telefonista, ainda estou esperando.
E deu as costas para os meninos.

HARDING


Através dos vidros dos óculos de visão noturna, o mundo aparecia em tons de verde fluorescente. Sarah Harding olhou para a savana africana. Diretamente à
frente, acima da relva alta, ela avistou a saliência rochosa de uma colina. Pequenos pontos verdes se refletiam nas rochas. Provavelmente alguns híraces, pensou
ela, ou outro pequeno roedor qualquer.
De pé no jipe, com um blusão de malha para se proteger do frio da noite, sentindo o peso dos óculos enormes, ela virava a cabeça lentamente. Ouvia o ganido
na noite e tentava descobrir de onde vinha.
Ela sabia que, mesmo de pé como estava, não poderia ver o animal. Virou devagar para o norte, esperando ver algum movimento na relva. Nada. Voltou-se rapidamente
para o outro lado e o mundo verde girou também. Agora estava olhando para o sul.
E ela os viu.
A relva ondulou num movimento variado quando a alcatéia correu para a frente, ganindo e latindo, preparada para o ataque. Sarah viu de relance a fêmea que
ela chamava de Face Um, ou Fl. Fl distinguia-se dos outros por uma linha branca entre os olhos. Fl seguiu com passos largos, com o corpo meio de lado, como correm
todas as hienas. Com os dentes arreganhados, ela olhou para trás, verificando a posição da alcatéia.
Sarah Harding moveu os óculos na escuridão, olhando para a frente da alcatéia e viu a presa. Uma manada de búfalos africanos, de pé na relva alta que ia até
suas barrigas, todos agitados. Os búfalos mugiam e batiam as patas no chão.
As hienas uivaram mais alto, um padrão sonoro destinado a confundir a presa. Correram para a manada tentando separar as crias das mães. O búfalo africano
parece lerdo e tolo, mas na verdade está entre os mamíferos selvagens africanos mais perigosos, criaturas pesadas e muito fortes com chifres pontiagudos e extremamente
mal-humoradas. As hienas não tinham meios para derrubar um adulto, a não ser que estivesse doente ou ferido.
Mas iam tentar apanhar um bezerro.
Sentado atrás da direção do jipe, Makena, seu assistente, perguntou:
- Você quer chegar mais perto?
- Não, aqui está ótimo.
Na verdade, estava mais do que ótimo. O jipe estava numa pequena elevação e a visão era boa. Com sorte, ela poderia gravar todo o padrão do ataque. Sarah
ligou a câmera de vídeo, montada num tripé um metro e meio acima da sua cabeça, e começou a ditar rapidamente no gravador.
- Fl sul, F2 e F5 um de cada lado a vinte metros. F3 no centro. F6 fazendo uma volta larga a leste. Não posso ver F7. Diretamente para a frente. F8 aproximando-se
diagonalmente do norte. Aparecendo, fazendo uma volta outra vez.
Era o comportamento clássico das hienas. Os líderes correm entre a manada, enquanto os outros fazem um círculo e depois avançam de todos os lados. O búfalo
não pode localizar todos os atacantes. Sarah ouviu o mugido dos búfalos quando a manada entrou em pânico e desfez a formação compacta. Os grandes animais separaram-se,
virando as cabeças, olhando. Harding não via as crias, estavam escondidas pela relva alta. Mas ouvia seus gritos lamentosos.
Agora as hienas estavam voltando. Os búfalos bateram os pés, abaixaram as cabeças ameaçadoramente. A relva ondulou quando as hienas armaram o círculo, uivando
e latindo, agora mais em staccato. Sarah viu de relance a fêmea F8, com o focinho já vermelho. Mas não chegou a ver o ataque.
A manada de búfalos andou um pouco para o leste e se reagrupou. Uma fêmea estava separada dos demais. Ela mugia continuamente para as hienas. Elas deviam
ter apanhado sua cria.
Harding ficou frustrada. Tudo aconteceu muito depressa - demasiado depressa, o que só podia significar que as hienas tinham tido sorte ou que o bezerro estava
ferido. Ou talvez fosse muito novo, até mesmo recém-nascido. Algumas fêmeas estavam ainda tendo suas crias. Precisava estudar o videoteipe e tentar reconstruir o
que tinha acontecido. Os perigos de estudar animais noturnos muito rápidos, pensou ela.
Mas não tinha dúvida de que as hienas haviam apanhado um animal. Todas estavam agrupadas numa mesma área no meio da relva, ganindo e saltando. Ela viu F3
e depois F5 com os focinhos sujos de sangue. Depois chegaram os filhotes para tirar sua parte da presa. Os adultos imediatamente abriram caminho para eles, e os
ajudaram a devorar o búfalo. Às vezes tiravam um pedaço de carne da carcaça e davam para os filhotes.
Sarah Harding, que recentemente havia se tornado a maior especialista em hienas no mundo, conhecia bem esse comportamento. Quando publicou suas descobertas,
foi recebida com incredulidade e até mesmo má-vontade pelos colegas, que discutiram os resultados do seu estudo em termos extremamente pessoais. Foi atacada por
ser mulher, por ser atraente, por ter uma "perspectiva predominantemente feminista". A universidade a advertiu de que ela era candidata a um cargo vitalício como
docente. Os colegas balançaram a cabeça. Mas Harding não desistiu, e lentamente, com o passar do tempo, à medida que acumulava mais dados, sua descrição do comportamento
das hienas foi sendo aceita.
Contudo, as hienas não podiam ser consideradas criaturas agradáveis, pensou ela, enquanto as via devorar a presa. Eram feias, a cabeça grande demais, o corpo
curvo, o pêlo sujo e emaranhado, o andar desajeitado, a voz lembrando demasiado uma risada sinistra. Num mundo cada vez mais urbano de arranha-céus de concreto,
os animais selvagens eram romantizados, classificados como nobres ou ignóbeis, heróis ou vilões. E nesse mundo dirigido pela mídia, as hienas simplesmente não eram
bastante fotogênicas para ser admiradas. Há muito tempo classificadas como os vilões que riam nas planícies da África, ninguém as julgava dignas de um estudo sistemático,
até Harding começar sua pesquisa.
O que ela descobriu mostrava as hienas por uma ótica muito diferente. Bravas caçadoras e pais zelosos, viviam numa notável e complexa estrutura social - além
de tudo, um matriarcado. Quanto ao famoso uivo ou gargalhada, representava uma forma sofisticada de comunicação.
Sarah ouviu um rugido e com seus óculos de visão noturna viu o primeiro leão aproximar-se da presa. Era uma leoa grande e se aproximava em círculos. As hienas
latiram e arreganharam os dentes para a leoa, afastando suas crias para o meio da relva alta. Logo surgiram outros leões e começaram a devorar a presa das hienas.
Agora, os leões, pensou ela. Esses, sim, são animais realmente malvados. Embora chamado o rei dos animais, o leão é na realidade cruel e...
O telefone tocou.
- Makena - ela disse.
O telefone tocou outra vez. Quem podia ser àquela hora?
Através dos óculos ela viu a leoa levantar a cabeça e olhar para dentro da noite.
Makena estava procurando o telefone debaixo do painel do jipe. Tocou mais três vezes antes de ele atender.
Sarah o ouviu dizer:
- Jambo, mzee. Sim, a Dra. Harding está aqui. - Estendeu o telefone para ela. - É o Dr. Thorne.
Com relutância, ela tirou os óculos de visão noturna e apanhou o telefone. Ela conhecia bem Thorne, quase todo o equipamento do seu jipe fora desenhado por
ele.
- Thorne, acho bom que seja importante.
- É importante - disse Thorne. - É sobre Richard.
- O que sobre Richard? - Sarah não compreendeu a preocupação que notou na voz dele. Ultimamente Levine estava sendo um chato de primeira, telefonando para
ela quase diariamente da Califórnia, procurando aprender tudo o que ela sabia sobre trabalho de campo com animais. Fazia perguntas sobre esconderijos, emboscadas,
protocolos de dados, organização de registros e assim por diante, interminavelmente.
- Ele chegou a dizer a você o que pretendia estudar? - perguntou Thorne.
- Não. Por quê?
- Nada mesmo?
- Não - repetiu Harding. - Estava muito misterioso. Mas eu concluí que ele havia localizado uma população animal que poderia usar para provar alguma coisa
sobre sistemas biológicos. Você sabe como ele é obcecado por isso. Por quê?
- Bem, ele desapareceu, Sarah. Malcolm e eu pensamos que está em apuros. Nós o localizamos numa ilha na Costa Rica e vamos para lá agora.
- Agora?
- Esta noite. Voamos de San José dentro de uma hora. Ian vai comigo. Gostaríamos que você viesse também.
- Thorne - ela disse. - Mesmo que tomasse um avião em Seronera amanhã de manhã para Nairóbi, levaria quase um dia para chegar lá. Isso se eu tiver sorte,
quero dizer...
- Você decide - interrompeu Thorne. - Vou dar os detalhes, e você resolve o que quer fazer.
Deu toda a informação, e ela anotou em um bloco preso no seu pulso. Depois Thorne desligou.
Sarah olhou para a noite africana, sentindo a brisa fria no rosto. No escuro ouviu o rosnado dos leões devorando a presa. Seu trabalho era ali. Sua vida era
ali.
Makena disse:
- Dra. Harding? O que vamos fazer?
- Vamos voltar. Preciso fazer as malas.
- Vai partir?
- Sim - disse Sarah. - Eu vou partir.

A MENSAGEM


Com Thorne na direção, foram para o aeroporto, as luzes de San Francisco desaparecendo atrás deles. Malcolm estava sentado ao lado dele. Olhou para trás,
para o Explorer que o seguia e disse:
- Eddie sabe do que se trata?
- Sabe - disse Thorne. - Mas não sei se ele acredita.
- E os garotos não sabem?
Ouviram um bip ao lado dele. Thorne apanhou o pequeno Envoy preto, um pager. Uma luz estava piscando. Thorne ligou a tela e o entregou para Malcolm.
- Leia para mim.
- É de Arby - disse Malcolm. - Diz: "Façam uma boa viagem. Se precisarem de nós, é só chamar. Estaremos aqui se precisarem da nossa ajuda." E dá o número
do telefone.
Thorne riu.
- A gente tem de gostar desses garotos. Nunca desistem. - Depois franziu a testa. - Qual é a hora da mensagem?
- Foi enviada há quatro minutos - disse Malcolm. - Via netcom.
- Tudo bem. Só checando.
Viraram para a direita, a caminho do aeroporto. Viam as luzes adiante. Malcolm olhou para a frente, sombrio.
- É uma imprudência nos precipitarmos deste modo. Não é o modo certo de fazer as coisas.
- Vai dar tudo certo - disse Thorne. - Desde que seja essa a ilha.
- É essa - disse Malcolm.
- Como você sabe?
- A pista mais importante foi uma coisa que eu não quis dizer para as crianças. Alguns dias atrás, Levine viu a carcaça de um dos animais.
-Oh?
- Sim. Ele teve oportunidade de ver de perto antes de a polícia queimar. E descobriu que o animal estava etiquetado. Ele cortou a etiqueta e a mandou para
mim.
- Etiquetado? Quer dizer, como...
- Sim. Como um espécime biológico. A etiqueta era antiga e tinha sinais de ácido sulfúrico.
- Deve ser vulcânico - disse Thorne.
- Exatamente.
- E você diz que era uma etiqueta antiga?
- De vários anos - disse Malcolm. - Porém o mais interessante foi descobrir como o animal morreu. Levine concluiu que o animal foi ferido enquanto vivo, um
corte profundo na perna que chegava até o osso.
- Está dizendo que o animal foi ferido por outro dinossauro?
- Sim. Exatamente.
Ficaram em silêncio por algum tempo.
- Quem mais sabe dessa ilha além de nós?
- Eu não sei - disse Malcolm. - Mas alguém está tentando descobrir. Hoje invadiram o meu escritório para tirar fotografias.
- Grande - suspirou Thorne. - Mas você não sabia onde ficava a ilha, sabia?
- Não. Eu ainda não tinha todos os dados.
- Acha que mais alguém pode ter?
- Não - disse Malcolm. - Estamos sozinhos.

A EXPLORAÇÃO

Lewis Dodgson abriu a porta onde estava escrito ALOJAMENTO DOS ANIMAIS, e imediatamente todos os cães começaram a latir. Dodgson seguiu pelo corredor entre
as gaiolas, umas sobre as outras, alcançando três metros de altura. O prédio era grande. A Biosyn Corporation de Cupertino, Califórnia, precisava de uma vasta área
para seus testes em animais.
Ao lado dele, Rossiter, o diretor da empresa, passou a mão na lapela do terno italiano.
- Eu detesto este maldito lugar. Por que me trouxe aqui?
- Porque precisamos falar sobre o futuro - disse Dodgson.
- Isto aqui fede - disse Rossiter, olhando para o relógio. - Vamos com isso. Fale de uma vez, Lewis.
- Podemos falar aqui. - Dodgson o levou para a cabine de vidro do superintendente, no centro do prédio. O vidro impedia que ouvissem os latidos. Mas podiam
ver os animais enjaulados.
- É simples - disse Dodgson, começando a andar de um lado para o outro. - Mas acho que é importante.
Lewis Dodgson tinha quarenta e cinco anos, rosto liso e uma calva incipiente. Seus traços eram jovens e seus modos suaves. Mas as aparências enganam - Dodgson,
com seu rosto de bebê, era um dos mais desumanos e agressivos geneticistas da sua geração. A controvérsia tinha acompanhado sua carreira. Quando estudante de graduação
na Hopkins, ele fora expulso por planejar uma terapia genética humana sem a permissão do FDA. Mais tarde, depois que começou a trabalhar para a Biosyn, conduziu
o teste bastante controvertido de uma vacina contra a raiva, no Chile - os agricultores ignorantes usados por ele não haviam sido informados de que estavam servindo
de cobaias.
Nos dois casos, Dodgson explicou que era um cientista muito apressado e não podia ser detido pelos regulamentos criados por pessoas de menor importância.
Ele se definia como "voltado para resultados", o que na realidade significava que fazia tudo o que considerasse necessário para atingir sua meta. Era também um incansável
mestre da autopromoção. Dentro da empresa, Dodgson se apresentava como um pesquisador, muito embora não tivesse habilidade para nenhuma pesquisa original e nunca
tivesse feito nenhuma. Seu intelecto era fundamentalmente derivativo. Dodgson jamais concebia uma idéia antes que alguém falasse primeiro no assunto. Ele era muito
bom em "desenvolvimento de pesquisa", ou seja, roubar o trabalho dos outros quando estavam nos primeiros estágios de estudo. Nesse particular Dodgson era completamente
sem escrúpulos e sem igual. Durante muitos anos dirigiu a seção de engenharia reversa da Biosyn, que, teoricamente, examinava os produtos dos concorrentes para determinar
como eram feitos. Mas na prática, a "engenharia reversa" envolvia uma boa parte de espionagem industrial.
Rossiter, é claro, não tinha ilusões sobre Dodgson. Não gostava dele e o evitava tanto quanto possível. Dodgson estava sempre correndo riscos, cortando caminho,
e deixava Rossiter nervoso. Mas Rossiter sabia também que a biotecnologia moderna era extremamente competitiva. Para continuar competitiva, cada empresa precisava
de um homem como Dodgson. E Dodgson era muito bom no que fazia.
- Vou direto ao assunto - disse Dodgson. - Se agirmos depressa, acho que teremos oportunidade de adquirir a tecnologia da InGen.
Rossiter suspirou.
- Outra vez, não...
- Eu sei, Jeff. Sei o que você pensa. Admito que há uma história nisso tudo.
- História? A única história é que você falhou, mais de uma vez. Já tentamos isso, pela porta da frente e pela porta dos fundos. Une diabo, tentamos até comprar
a empresa quando ela entrou em concordata, porque você nos disse que estava à venda. Mas acontece que não estava. Os japoneses não queriam vender. .
- Eu compreendo, Jeff. Mas não vamos esquecer que...
- O que eu não posso esquecer - disse Rossiter - é que pagamos setecentos e cinqüenta mil dólares para seu amigo Nedry e ficamos de mãos vazias.
- Mas, Jeff...
- Depois pagamos quinhentos mil dólares para aquele agente matrimonial, Dai-Ichi. Não vimos nada também. Nossas tentativas de adquirir a tecnologia da InGen
foram um fracasso de merda. É isso o que eu não posso esquecer.
- Mas o caso - disse Dodgson - é que continuamos tentando por uma boa razão. Essa tecnologia é vital para o futuro da empresa.
- É o que você diz.
- O mundo está mudando, Jeff. Estou falando em resolver um dos problemas mais importantes desta empresa no século XXI.
- E qual é o problema?
Dodgson apontou para os cães, que continuavam a ladrar.
- Experiências com animais. Vamos encarar os fatos, Jeff. Cada ano a pressão fica maior no sentido de proibir o uso de animais para testes e pesquisa. A
cada ano aumenta o número de demonstrações de protesto, mais invasões, mais ataques da imprensa. No princípio eram só os fanáticos simplórios e as celebridades de
Hollywood. Mas agora é um movimento vitorioso, até as universidades, os filósofos estão começando a dizer que é contra a ética submeter macacos, cães e até mesmo
ratos às indignidades da pesquisa de laboratório. Tivemos até protestos contra nossa "exploração" das lulas, embora elas continuem em todas as mesas do mundo. Ouça
o que eu digo, Jeff, é uma moda sem fim. Qualquer dia alguém vai dizer que não podemos explorar as bactérias para fazer produtos genéticos.
- Ora, deixe disso.
- Espere para ver. Vai acontecer. E então fecharemos as portas. A não ser que tenhamos um animal genuinamente criado por nós. Pense um pouco - um animal
extinto, trazido de volta à vida, para todos os fins práticos não é um animal, não pode ter nenhum direito. Já está extinto. Portanto, se ele existe, só pode ser
uma coisa que nós fizemos. Nós o fizemos, nós o patenteamos, ele nos pertence. E é um perfeito objeto para testes. E acreditamos que os sistemas, as enzimas e os
hormônios dos dinossauros são idênticos aos sistemas dos mamíferos. No futuro, os medicamentos podem ser testados em pequenos dinossauros com o mesmo sucesso com
que são hoje testados em cães e ratos, com muito menor risco de um processo legal. Rossiter balançou a cabeça.
- E o que você pensa.
- Eu sei. Basicamente eles são lagartos grandes, Jeff. E ninguém gosta de lagartos. Não são como aqueles cãezinhos engraçadinhos que lambem sua mão e comovem
seu coração. Os lagartos não têm personalidade. São cobras com pernas.
Rossiter suspirou.
- Jeff, estamos falando de verdadeira liberdade. Porque neste momento tudo o que é relacionado com animais vivos está amarrado com nós legais e morais. Os
caçadores de animais de grande porte não podem matar um leão ou um elefante, os mesmos animais que seus pais e seus avós costumavam caçar para depois posar orgulhosamente
para a foto. Agora existem formulários, licenças, despesas - e muito sentimento de culpa. Hoje em dia você não tem coragem de atirar num tigre e admitir que atirou.
No mundo moderno matar um tigre é uma transgressão muito mais séria do que matar os próprios pais. Os tigres têm seus defensores. Mas, agora, imagine. Uma reserva
de caça especialmente equipada, talvez em algum lugar da Ásia, onde pessoas ricas e importantes podem caçar tiranossauros e tricerátops num ambiente natural. Seria
uma atração incrivelmente desejável. Quantos caçadores têm uma cabeça de alce empalhada na parede? O mundo está cheio deles. Mas quantos podem se gabar de ter a
cabeça de um tiranossauro com os dentes arreganhados pendurada acima do seu bar?
- Não fala sério.
- Estou tentando explicar a importância do assunto, Jeff. Os animais são completamente exploráveis. Podemos fazer o que quisermos com eles.
Rossiter levantou-se e pôs as mãos nos bolsos. Suspirou, depois olhou para Dodgson.
- Os animais ainda existem?
Dodgson balançou a cabeça lenta e afirmativamente.
- E você sabe onde estão? Outra vez o mesmo movimento.
- Tudo bem - disse Rossiter. - Pois então faça. Caminhou para a porta, parou e olhou para trás.
- Mas, Lewis, quero que fique bem claro. Esta é decididamente a última vez. Ou você consegue os animais agora, ou está acabado. Esta é a última vez. Entendeu?
- Não se preocupe - disse Dodgson. - Desta vez eu vou conseguir.

TERCEIRA CONFIGURAÇÃO


Na fase intermediária, o desenvolvimento rápido
da complexidade no interior do sistema disfarça
o risco do caos iminente. Mas o risco está lá.

IAN MALCOLM

COSTA RICA


Chovia copiosamente em Puerto Cortês. A chuva batia com força no teto do pequeno galpão de metal ao lado do aeroporto. Completamente molhado, Thorne esperou
que o funcionário da alfândega da Costa Rica examinasse repetidamente seus documentos. O nome dele era Rodríguez e era apenas um rapaz de vinte e poucos anos, com
um uniforme deselegante e morrendo de medo de cometer algum erro.
Thorne olhou para a pista, onde à luz incerta do amanhecer os conteineres de carga estavam sendo presos à parte inferior de dois grandes helicópteros Huey.
Eddie Carr estava fora na chuva, com Malcolm, gritando para orientar os homens que fixavam as presilhas da carga.
Rodríguez folheou outra vez os papéis.
- Agora, Senor Thorne, de acordo com estes documentos, seu destino é a Islã Sorna...
- Exatamente.
- E seus contêineres contém apenas veículos?
- Sim, isso mesmo. Veículos de pesquisa.
- Sorna é um lugar primitivo. Não há suprimento de combustível, nem mesmo o que se possa chamar de estrada...
- Já esteve lá?
- Não. As pessoas daqui não se interessam por essa ilha. É um lugar selvagem, rochas e selva. E não há lugar para atracar um barco, exceto em condições atmosféricas
muito especiais. Por exemplo, hoje não se pode chegar à ilha.
- Compreendo - disse Thorne.
- Espero que estejam bem preparados para as dificuldades que vão encontrar.
- Acho que estamos.
- Estão levando combustível suficiente para os veículos? Thorne suspirou. Para que ter o trabalho de explicar?
- Sim, estamos.
- E são apenas três pessoas, o Dr. Malcolm, o senor e seu assistente, o Senor Carr?
- Correto.
- E pretendem ficar na ilha menos de três semanas?
- Exatamente. Talvez uns dois dias. Se tivermos sorte, esperamos sair da ilha amanhã.
Rodríguez examinou os documentos outra vez, como se estivesse procurando uma pista secreta.
- Bem...
- Algum problema? - perguntou Thorne, consultando o relógio.
- Nenhum problema, Senor. Sua permissão está assinada pelo diretor geral das Reservas Biológicas. Está tudo em ordem... - Rodríguez hesitou. - Mas essa permissão
é bastante incomum.
- Por quê?
- Eu não conheço os detalhes, mas há alguns anos houve algum problema numa das ilhas e desde então o Departamento de Reservas Biológicas fechou aos turistas
todas as ilhas do Pacífico.
- Não somos turistas - disse Thorne.
- Eu sei disso, Senor Thorne.
Tornou a examinar os documentos.
- Thorne esperou.
Na pista, as presilhas pareciam estar todas encaixadas e os contêineres foram erguidos do solo.
- Muito bem, Senor Thorne - Rodríguez disse, finalmente, carimbando os papéis. - Desejo boa sorte.
- Muito obrigado - disse Thorne. Guardou os documentos no bolso, inclinou a cabeça para se proteger da chuva e correu para a pista.
Quatro quilômetros ao largo da costa, os helicópteros atravessaram a camada de nuvens para o sol do começo da manha. Do cockpit do Huey que ia na frente,
Thorne avistava toda a costa. Viu cinco ilhas a distâncias variadas da costa - picos rochosos erguendo-se do mar azul. Eram separadas umas das outras por apenas
alguns quilômetros, sem dúvida parte de uma antiga cadeia vulcânica. Ele apertou o botão para transmitir.
- Qual delas é Sorna?
O piloto apontou para a frente.
- Nós as chamamos de Cinco Mortes - disse ele. - Isla Muerte, Isla Matanceros, Isla Pena, Isla Tacana e Isla Sorna, que é aquela grande ao norte.
- Você já esteve lá?
- Nunca, Senor. Mas acredito que haja um lugar para pousar.
- Como sabe?
- Há alguns anos houve alguns vôos para a ilha. Ouvi dizer que os americanos voavam até lá às vezes.
- Não eram alemães?
- Não, não. Não temos tido alemães desde... eu nem sei quando. A guerra mundial. Eram americanos.
- Quando foi isso?
- Não tenho certeza. Talvez há uns dez anos.
O helicóptero virou para o norte, passando sobre a ilha mais próxima. Thorne viu terreno acidentado e vulcânico, coberto pela selva densa. Não havia sinal
de vida ou de habitação humana.
- Para os habitantes locais, essas ilhas não são lugares felizes - disse o piloto. - Eles dizem que nada de bom pode vir delas. - Ele sorriu. - Mas eles não
sabem de nada. São índios supersticiosos.
Estavam agora sobre mar aberto com a Isla Sorna diretamente na frente. Era sem dúvida uma cratera vulcânica. Paredes de rocha nuas, avermelhadas, um cone
gasto pela erosão.
- Onde os barcos atracam?
O piloto apontou para onde o mar batia nos rochedos escarpados.
- No lado leste desta ilha, há várias cavernas, feitas pelas ondas. Alguns dos habitantes locais a chamam de Isla Gemido, por causa do barulho das ondas
dentro das cavernas. Algumas dessas cavernas estendem-se para o interior e um barco pode passar por elas em determinadas épocas. Mas não como tempo que temos hoje.
Thorne pensou em Sarah Harding. Se tivesse resolvido vir, deveria chegar mais tarde.
- Tenho uma colega que talvez chegue hoje à tarde - disse. - Pode trazê-la até a ilha?
- Eu sinto muito - disse o piloto. - Temos um trabalho em Golfo Juan. Só voltaremos à noite.
- O que ela pode fazer?
O piloto olhou atentamente para o mar.
- Talvez possa vir de barco. O mar muda de uma hora para outra. Ela pode ter sorte.
- E você vai voltar amanhã para nos levar de volta?
- Sim, Senor Thorne. Voltaremos bem cedo. É a melhor hora para os ventos.
O helicóptero fez a aproximação pelo oeste, subindo algumas dezenas de metros, sobrevoando os rochedos para revelar o interior da Islã Gemido. Parecia exatamente
como outras cadeias e desfiladeiros vulcânicos, recoberta pela mata densa. Era bela vista do ar, mas Thorne sabia que ia ser extremamente difícil se movimentar no
solo. Olhou atentamente para baixo, à procura de estradas.
O helicóptero desceu um pouco, voando em círculos sobre a área central da ilha. Thorne não viu nenhuma construção, nenhuma estrada. O helicóptero começou
a descer na direção da selva. O piloto disse:
- Por causa dos rochedos os ventos aqui são péssimos. Muitas rajadas e correntes. Só num ponto da ilha é seguro pousar. - Olhou pela janela. - Ah, sim. Lá
está.
Thorne viu uma clareira atapetada por relva alta.
- Nós pousamos ali - disse o piloto.

ISLÃ SORNA


Eddie Carr, de pé na relva alta da clareira, deu as costas para a poeira levantada pelos dois helicópteros, que já levantavam vôo. Alguns minutos depois eram
pequenos pontos ao longe e quase não se ouviam os motores. Eddie pôs a mão em pala na testa e olhou para cima. Perguntou, com desânimo na voz:
- Quando vão voltar?
- Amanhã de manhã - disse Thorne. - A essa hora já teremos encontrado Levine.
- Pelo menos, é bom que o tenhamos encontrado - disse Malcolm.
Então os helicópteros desapareceram completamente no outro lado da cratera. Carr ficou com Malcolm na clareira, envolta pelo calor do sol da manhã e pelo
silêncio profundo da ilha.
- Isto aqui é de arrepiar - disse Eddie, puxando a aba do boné de beisebol para baixo, sobre os olhos.
Eddie Carr tinha vinte e quatro anos e crescera em Daly City. fisicamente era compacto e forte e tinha cabelos escuros. O corpo era atarracado, os músculos
salientes mas as mãos elegantes, com dedos longos e bem-feitos. Eddie tinha um talento - Thorne diria um gênio - para coisas mecânicas. Eddie podia construir qualquer
coisa, consertar qualquer coisa. Via como as coisas funcionavam apenas olhando para elas. Trabalhava para Thorne há três anos, seu primeiro emprego depois que se
formou no colégio comunitário. Era para ser um emprego temporário. Queria ganhar dinheiro para voltar a estudar e conseguir um diploma universitário. Mas Thorne
logo se tornou dependente de Eddie. Quanto a Eddie, não estava mesmo muito interessado em voltar aos livros.
Apesar disso tudo, não contava com uma coisa como essa, pensou ele, olhando em volta. Eddie era um homem da cidade, acostumado ao movimento urbano, às buzinas
e ao tráfego intenso. Aquele silêncio desolador o deixava nervoso.
- Venha - disse Thorne, pondo a mão no ombro dele. - Vamos começar.
Caminharam para os contêineres que os helicópteros haviam deixado a poucos metros, na relva alta.
- Posso ajudar? - perguntou Malcolm, a alguma distância dos dois.
- Se não se importa, não - disse Eddie. - Acho melhor nós mesmos nos encarregarmos disto.
Levaram meia hora para desaparafusar os painéis traseiros, abaixá-los no chão e entrar nos contêineres. Depois disso, em poucos minutos retiraram os veículos.
Eddie entrou no Explorer e ligou o motor, que pegou com um leve murmúrio quase inaudível da bomba de vácuo. Thorne disse:
- Como está a sua carga?
- Completa - disse Eddie.
- Baterias em ordem?
- Sim. Parecem ótimas.
Foi um alívio para Eddie. Ele havia supervisionado a conversão dos motores dos veículos para motores movidos a eletricidade, mas fora um trabalho feito às
pressas e não haviam tido tempo para uma revisão. Embora os carros elétricos tivessem uma tecnologia menos complexa que a dos motores de combustão interna - aquela
relíquia resfolegante do século XIX -, Eddie sabia que era sempre arriscado levar para o campo equipamento não-testado.
Especialmente quando o equipamento usava também a mais nova tecnologia. Isso o preocupava mais do que ele queria admitir. Como a maioria dos mecânicos natos,
Eddie era profundamente conservador. Gostava que as coisas funcionassem - em qualquer situação - e para ele isso significava o uso de tecnologia estabelecida e comprovada.
Infelizmente dessa vez ele fora derrotado na votação.
Duas coisas o preocupavam especialmente. Uma eram os painéis fotovoltaicos, com as fileiras de lâminas octogonais de silício montadas na capota e no capo
dos veículos. Esses painéis eram eficientes e muito menos frágeis do que os antigos fotovoltaicos. Eddie os montou com unidades especiais amortecedoras da vibração,
criadas por ele. Mas permanecia o fato. Se os painéis fossem avariados de qualquer modo, já não poderiam fornecer carga para os veículos nem controlar a parte eletrônica.
Todos os sistemas cessariam de funcionar.
Sua outra preocupação eram as baterias. Thorne tinha escolhido as novas baterias de íons de lítio da Nissan, extremamente eficientes em termos de peso. Mas
estavam ainda em fase experimental, o que para Eddie era um modo delicado de dizer "não-confiável".
Eddie sugeriu que levassem alguma garantia - só por segurança -, como um gerador a gasolina. Ele havia sugerido uma porção de outras coisas. E todas as suas
sugestões foram descartadas. Nessas circunstâncias, Eddie fez a coisa mais sensata possível. Construiu algumas peças extras e não contou a ninguém.
Ele tinha certeza de que Thorne sabia. Mas Thorne não disse nada. Eddie também não tocou no assunto. Mas agora que estava naquela ilha, no meio do nada, ficou
feliz por ter feito isso. Porque o fato é que, nunca se sabe.
Thorne observou Eddie tirar o Explorer do contêiner de marcha à ré e levá-lo para a relva. Eddie deixou o carro no centro da clareira, onde a luz do sol podia
atingir os painéis, reforçando a carga.
Thorne sentou na frente da direção do primeiro trailer e deu marcha à ré. Era estranho dirigir um veículo tão silencioso. O ruído mais alto era dos pneus
no contêiner de metal. E andando sobre a relva, nem se ouvia. Thorne desceu e uniu os dois trailers com a conexão de aço flexível em forma de sanfona.
Chegou a vez da motocicleta, também elétrica. Thorne a levou para trás do Explorer, apoiou a máquina nos suportes, ligou o cabo de força no mesmo sistema
do veículo e recarregou a bateria. Depois recuou um pouco.
- Isso é tudo.
Na clareira quente e silenciosa, Eddie olhou para a borda alta e circular da cratera que se erguia à distância acima da selva. A rocha nua cintilava com ondas
de calor, uma parede ameaçadora e áspera. Teve uma sensação de abandono, de estar encurralado.
- Por que alguém ia querer vir a este lugar? - ele perguntou. Malcolm, apoiado na bengala, sorriu.
- Para fugir de tudo, Eddie. Você nunca tem vontade de fugir de tudo?
- Não se depender de mim - disse Eddie. - Eu gosto de ter sempre um Pizza Hut por perto, sabe o que quero dizer?
- Bem, pois está muito longe dele agora.
Thorne voltou para o painel traseiro do trailer e tirou dois rifles pesados. Sob o cano de cada um havia duas latas de alumínio. Entregou um rifle para Eddie
e mostrou o outro para Malcolm.
- Já tinha visto um destes?
- Eu li a respeito - disse Malcolm. - E aquela coisa sueca?
- Certo. Rifle de ar Lindstradt. O rifle mais caro do mundo. Forte, simples, preciso e confiável. Atira um dardo de impacto subsônico Fluger, contendo o que
você quiser. - Thorne abriu o tambor, mostrando uma fileira de sacos de plástico com líquido cor-de-palha. Cada cartucho tinha na ponta uma agulha de sete centímetros.
- Carregamos com o veneno reforçado de Conus purpurascens, a concha cônica dos Mares do Sul. E a neurotoxina mais poderosa do mundo. Age em dois milionésimos de
segundo. Mais rápida do que a velocidade da condução da rede nervosa. O animal cai antes de sentir a picada do dardo.
- Letal?
Thorne fez um gesto afirmativo.
- É preciso muito cuidado. Lembre-se, você não vai querer acertar um deste no seu pé, porque, se isso acontecer, estará morto antes de saber que puxou o gatilho.
- Há algum antídoto?
- Não. Mas para quê? Não daria tempo de ser administrado, se houvesse.
- Isso simplifica as coisas - disse Malcolm, apanhando a arma.
- Só achei que você devia saber - disse Thorne. - Eddie? Vamos embora.

O REGATO
Eddie entrou no Explorer e Thorne e Malcolm no primeiro trailer. Um momento depois, o rádio estalou e Eddie disse:
- Thorne, ligou o banco de dados?
- Estou ligando - disse Thorne.
Ligou o disco óptico no painel. No pequeno monitor apareceu a ilha, mas quase toda obscurecida por grupos separados de nuvens.
- Para que serve isso? - perguntou Malcolm.
- Espere um pouco -respondeu Thorne. - É um sistema. Vai processar os dados.
- Dados de quê?
- Radar.
Em um instante uma imagem de radar de um satélite apareceu sobre a foto. O radar podia penetrar as nuvens. Thorne apertou um botão e o computador delineou
as bordas, reforçando os detalhes, acentuando o traçado fino do sistema de estradas.
- Impressionante - disse Malcolm. Thorne sentiu que ele estava tenso.
- Já peguei! - disse Eddie, no rádio.
- Ele está vendo a mesma coisa? - perguntou Malcolm.
- Sim, no painel.
- Mas eu não estou pegando o GPS - disse Eddie, ansioso. - Não está funcionando?.
- Ah, vocês - disse Thorne. - Dêem um tempo. Ele está fazendo a leitura óptica. As estações próximas estão chegando.
Havia um GPS, o sensor de posicionamento global, cênico, instalado no teto do trailer. O GPS, apanhando os dados de rádio da órbita de navegação dos satélites,
a milhares de quilômetros acima dele, podia calcular a posição dos veículos numa área de poucos metros. Então apareceu um X vermelho piscando no mapa da ilha.
- Tudo bem - Eddie disse no rádio. - Já peguei. Parece uma estrada que sai da clareira na direção norte. É para lá que nós vamos?
- Eu diria que sim - respondeu Thorne. - De acordo com o mapa, a estrada serpenteia pelo interior da ilha por vários quilômetros antes de chegar ao lugar
onde todas as estradas parecem convergir. Havia uma sugestão de construções nesse ponto, mas é difícil ter certeza.
- Tudo bem, Thorne. Aqui vamos nós.
Eddie passou por eles, tomando a dianteira. Thorne pisou no acelerador, e o trailer moveu-se silenciosamente, atrás do Explorer. Malcolm estava calado, entretido
com um pequeno computador notebook. Nem uma vez ele olhou para fora.
Deixaram a clareira para trás e dirigiram-se para a selva. As luzes do painel piscaram, indicando que o veículo estava agora ligado às baterias. Sob as árvores,
a luz do sol não era suficiente para mover o trailer. Continuaram o caminho.
- Como vai indo, Thorne? - perguntou Eddie. - Conservando carga?
- Está tudo ótimo, Eddie.
- Ele parece nervoso - disse Malcolm.
- Só preocupado com o equipamento.
- Nada disso - disse Eddie. - Estou preocupado comigo.
Embora a estrada estivesse cheia de mato e em péssimo estado, estavam indo bem. Depois de uns dez minutos chegaram a um pequeno regato de margens lamacentas.
O Explorer começou a atravessar e depois parou. Eddie saiu do carro e, andando por cima das pedras, foi até o trailer.
- O que foi?
- Eu vi alguma coisa, Thorne.
Thorne e Malcolm desceram do trailer e foram até a margem do regato. Ouviram gritos distintos que pareciam de pássaros. Malcolm olhou para cima, franzindo
a testa.
- Pássaros? - perguntou Thorne.
Malcolm balançou a cabeça negativamente. Eddie abaixou e apanhou na lama um pedaço de tecido. Era Gore-Tex verde-escuro,
com uma tira de couro costurada na ponta.
- Isto é de uma das nossas mochilas de expedição - ele disse.
- Aquela que fizemos para Levine?
- Sim, Thorne.
- Você pôs um sensor na mochila? - perguntou Thorne. Geralmente eles costuravam sensores de localização no interior das mochilas para expedições.
- Sim.
- Posso ver isso? - pediu Malcolm. Apanhou a tira de fazenda e a ergueu contra a luz. Depois, esfregou a borda rasgada? com dois dedos, pensativamente.
Thorne tirou um pequeno receptor do cinto. Parecia um pager grande demais. Olhou para o visor de cristal líquido.
- Não estou recebendo nenhum sinal...
Eddie olhou para a margem e abaixou outra vez.
- Aqui está outro pedaço do tecido. E outro. Parece que a mochila foi feita em pedaços, Thorne.
Outro grito de pássaro flutuou até eles, distante, como vindo de outro mundo. Malcolm olhou para longe, tentando localizar a fonte. E então ouviu Eddie dizer:
- Oh, oh, temos companhia.

Uma meia dúzia de animais verdes, parecidos com lagartos, estavam parados ao lado do trailer. Eram do tamanho de galinhas c pareciam conversar animadamente.
Estavam de pé, apoiados nas pernas traseiras, as caudas retas ajudando no equilíbrio. Quando andavam, balançavam as mãos para baixo e para cima, com movimentos curtos
e nervosos, exatamente como uma galinha. E faziam um ruído que lembrava um pássaro, um chiado estridente, mas pareciam lagartos, com suas caudas compridas. Tinham
rostos curiosos e alertas e inclinaram a cabeça para o lado quando olharam pura os homens.
Eddie disse:
- O que é isto? Uma convenção de salamandras?
Os lagartos verdes ficaram parados, observando. Vários outros apareceram, saindo de trás do trailer e da folhagem. Logo havia dezenas de lagartos olhando
e tagarelando.
- Comps - disse Malcolm. - Procompsognathus triassicus é o nome científico.
- Quer dizer que são...
- Sim. São dinossauros.
Eddie franziu a testa e olhou para os animais.
- Eu não sabia que podiam ser tão pequenos - ele disse, finalmente.
- A maioria dos dinossauros era pequena - disse Malcolm. - Todos pensam que eram enormes, mas o dinossauro comum tinha o tamanho de uma ovelha ou de um pequeno
pônei.
- Parecem galinhas - disse Eddie.
- Sim. Muito parecidos com pássaros.
- São perigosos? - perguntou Thorne.
- Na verdade, não - respondeu Malcolm. - São pequenos necrófagos, como os chacais. Alimentam-se de animais mortos. Mas eu não chegaria muito perto. A mordida
deles é extremamente venenosa.
- Eu não vou chegar perto - Eddie disse. - Eles me dão arrepios. É como se não tivessem medo de nós.
Malcolm já havia notado isso.
- Imagino que seja porque nunca viram um ser humano nesta ilha. Esses animais não têm nenhum motivo para temer o homem.
- Muito bem, vamos dar um motivo - disse Eddie, apanhando uma pedra.
- Ei! - exclamou Malcolm. - Não faça isso! E uma... Mas Eddie já tinha atirado a pedra, que caiu perto de um grupo
de comps e eles recuaram. Mas os outros nem se moveram. Alguns começaram a saltar, demonstrando agitação. Mas ficaram onde estavam. Tagarelando e com as cabeças
inclinadas para o lado.
- De arrepiar - disse Eddie. Farejou o ar. - Estão sentindo o cheiro?
- Sim - disse Malcolm. - Eles têm um cheiro característico.
- Cheiro de podre, isso sim - disse Eddie. - Cheiram a coisa podre. Como uma coisa morta. E, se quiser saber, não é natural um animal não demonstrar nenhum
medo. E se estiverem com raiva ou coisa assim?
- Não estão - garantiu Malcolm.
- Como sabe?
- Porque só os mamíferos contraem raiva... - Mas antes mesmo de terminar a frase, Malcolm se perguntou se estava certo. Animais de sangue quente transmitem
a raiva. Os comps seriam animais de sangue quente? Não tinha certeza.
As folhas farfalharam acima deles. Malcolm olhou para o dossel formado pelas árvores. Viu movimento na folhagem, no alto, animais invisíveis, saltando de
galho em galho. Ouviu gritos e pios, definitivamente ruídos de animais.
- Não são pássaros lá em cima - Thorne disse. - Macacos?
- Talvez, mas eu duvido - disse Malcolm. Eddie estremeceu.
- Vamos dar o fora daqui.
Voltou para o regato e entrou no Explorer. Malcolm e Thorne, andando cautelosamente, voltaram para o trailer. Os comps abriram caminho para eles, mas não
fugiram. Ficaram em volta das pernas dos dois homens, tagarelando excitados. Malcolm e Thorne entraram e fecharam as portas com cuidado, para não bater com elas
nas pequenas criaturas.
Thorne ligou o motor. Na frente deles, Eddie já estava no meio do regato, a caminho da outra margem íngreme.
- Os, hum... procomso-seja-lá-o-que-forem - Eddie disse, no rádio. - Eles são reais, não são?
- Oh, sim - Malcolm disse, em voz baixa. - Eles são reais.

A ESTRADA


Thorne estava inquieto. Começava a compreender o que Eddie sentia. Ele havia construído aqueles veículos e tinha uma sensação de isolamento, de estar naquele
lugar perdido e distante sem equipamento devidamente testado. Há quinze minutos estavam subindo a estrada íngreme, no meio da selva escura. Dentro do trailer o calor
começava a ficar desagradável. Malcolm perguntou:
- Ar-condicionado?
- Não quero gastar a bateria.
- Importa-se se eu abrir a janela?
- Se acha que convém... - disse Thorne. Malcolm deu de ombros.
- Por que não? - Apertou o botão e o vidro abaixou. O ar quente entrou no carro. Ele olhou para Thorne. - Nervoso?
- Claro - disse Thorne. - Pode apostar que estou. - Mesmo com a janela aberta, o suor descia no seu peito.
No rádio, Eddie estava dizendo:
- Vou dizer uma coisa: nós devíamos ter testado o equipamento antes, Thorne. Devíamos ter feito tudo de acordo com as regras. A gente não vem a um lugar com
galinhas venenosas quando não se tem certeza de que os veículos vão funcionar direito.
- O carro está ótimo - disse Thorne. - Como estão seus níveis?
- Normais altos - disse Eddie. - Tudo ótimo. E claro que só andamos oito quilômetros. São nove horas da manhã, Thorne.
A estrada ia para a direita, depois para a esquerda, seguindo numa série de ziguezagues quando o terreno ficava mais íngreme.
Conduzindo os dois grandes trailers, era um alívio para Thorne ter de se concentrar na direção para evitar outros pensamentos.
Na frente deles, o Explorer virou para a esquerda, continuando a subida.
- Não vi mais nenhum animal - disse Eddie, com alívio. Finalmente, depois de chegar ao topo da subida, a estrada ficou plana. De acordo com o que mostrava
o GPS, estavam indo para noroeste, para o interior da ilha. Mas a selva ainda os cercava por todos os lados, e não viam muita coisa além da densa parede de folhagem.
Chegaram a uma bifurcação em Y, e Eddie parou num dos lados da estrada. Thorne viu uma placa de madeira na junção do Y com setas apontando para as duas direções.
A da esquerda, com as letras quase apagadas, dizia "Para o Pântano". A da direita indicava "Para o Sítio B".
Eddie perguntou:
- Vocês aí, para onde vamos?
- Para o Sítio B - disse Malcolm.
- A caminho. - O Explorer entrou na estrada da direita. Thorne foi atrás. A direita o vapor amarelo de enxofre erguia-se do solo, manchando de branco a folhagem.
O cheiro era forte.
- Vulcânico - Thorne disse para Malcolm. - Como você previa.
Passaram pelas nuvens de vapor e viram a cavidade com o líquido fervente, com crostas espessas e amarelas nas bordas.
- É - disse Eddie -, mas é ativo. Para falar a verdade, eu diria que... caramba! - As luzes de freio do Explorer acenderam e o carro parou de repente.
Thorne teve de desviar bruscamente, amassando as samambaias ao lado da estrada, para não bater. Parou ao lado do Explorer e olhou zangado para Eddie.
- Eddie, pelo amor de Deus, será que você podia...
Mas Eddie não estava ouvindo.
Estava olhando para a frente de boca aberta. Thorne olhou também.
As árvores ao lado da estrada tinham sido derrubadas, criando uma abertura na folhagem. Podiam avistar a estrada toda atravessando a ilha para o leste. Mas
Thorne mal percebeu a vista panorâmica, porque o que estava vendo era um animal grande, do tamanho de um hipopótamo, andando na estrada. Só que não era um hipopótamo.
Era marrom-claro, a pele coberta por enormes escamas que pareciam placas de metal. Em volta da cabeça tinha uma crista óssea curva e no alto da crista dois chifres
de ponta redonda. Um terceiro chifre saía do nariz.
No rádio eles ouviam a respiração entrecortada de Eddie.
- Vocês sabem o que é isso?
- Isso é um tricerátops - disse Malcolm. - Jovem ainda, ao que parece.
- Deve ser - disse Eddie. Na frente deles, outro animal, duas vezes maior do que o primeiro, atravessou a estrada, com chifres longos, curvos e pontiagudos.
- Porque essa é a mãe dele.
Um terceiro tricerátops apareceu, depois um quarto. Um bando inteiro das criaturas atravessava a estrada. Não deram nenhuma atenção aos veículos, passaram
pela abertura na folhagem e desceram a colina, desaparecendo.
Só então os três homens puderam ver o que havia depois da abertura. Thorne viu uma grande planície pantanosa com um rio largo no centro. Na outra margem do
rio, viram animais pastando. Ao sul havia uns vinte dinossauros verdes de tamanho médio levantando e abaixando a cabeça grande, comendo a relva na margem do rio.
Mais perto, Thorne viu oito dinossauros com focinhos em forma de bico-de-pato e cristas grandes em forma de tubos, grasnando lamentosamente. Bem na frente, viu um
estegossauro sozinho, com a curva nas costas e as fileiras verticais de placas cobrindo o corpo todo. A manada de tricerátops passou lentamente pelo estegossauro
sem despertar sua atenção. A oeste, erguendo-se acima das árvores de um pequeno bosque, viram uma dezena de pescoços longos e graciosos de apatossauros, os corpos
escondidos pela folhagem que eles comiam preguiçosamente. Era uma cena tranqüila, mas uma cena de outro mundo.
- Thorne? - disse Eddie. - Que lugar é este?

SÍTIO B


Sentados nos carros, eles olharam para a planície. Viram os dinossauros movendo-se lentamente na relva alta. Ouviram o grito surdo dos bicos-de-pato. As manadas
moviam-se pacificamente ao lado do rio. Eddie disse:
- Então, o que estamos vendo? Um lugar esquecido pela evolução? Um desses lugares onde o tempo fica parado?
- Não - disse Malcolm. - Há uma explicação perfeitamente racional para o que você está vendo. E nós vamos...
Um bip agudo soou no painel. No mapa do GPS apareceu uma grade azul com um ponto triangular piscante e as letras LEVN.
- É ele! - disse Eddie. - Nós encontramos o filho da mãe!
- Está lendo isso? - disse Thorne. - Está muito fraco...
- Está ótimo, tem força suficiente de sinal para transmitir o código de identificação. E Levine, sem dúvida. Parece que vem daquele vale adiante.
Eddie ligou o motor do Explorer e disse:
- Vamos. Quero dar o fora daqui.
Thorne levantou um interruptor, ligando o motor elétrico do trailer, e ouviu a batida da bomba de vácuo, o zumbido da transmissão automática. Ligou a marcha
e seguiu o Explorer.
A selva impenetrável se fechou em volta deles outra vez, cerrada e quente. As árvores na frente bloqueavam quase toda a luz tio sol. O bip começou a ficar
irregular. Thorne olhou para o monitor e viu que o triângulo piscante desaparecia e voltava.
- Nós o estamos perdendo, Eddie? - ele perguntou.
- Não tem importância que o percamos - disse Eddie. - Temos sua localização agora e podemos ir direto para lá. Na verdade, deve ser logo adiante, nesta estrada.
Thorne olhou para além do Explorer e viu uma estrutura de concreto e uma barreira caída para o lado. Parecia uma casa da guarda. Estava maltratada e coberta
de trepadeiras. Continuaram e chegaram a uma estrada asfaltada. A folhagem fora cortada, abrindo quinze metros de cada lado. Logo chegaram a uma segunda casa da
guarda e a uma segunda barreira.
Seguiram por mais uns cem metros, a estrada ainda acompanhando a curva da cordilheira. A folhagem tornou-se esparsa, e através das aberturas Thorne viu construções
de madeira, todas pintadas de verde. Pareciam galpões para guardar equipamento. Teve a impressão de estar entrando num complexo muito bem aparelhado.
E então, de repente, quando saíram de uma curva, viram todo o complexo num plano abaixo de onde estavam, mais ou menos a oitocentos metros de distância.
Eddie disse:
- Que diabo é aquilo?

Thorne olhava atônito. No centro da clareira viu o telhado plano de um prédio enorme. Cobria uma vasta área, estendendo-se à distância. Tinha o tamanho de
dois campos de futebol. Além do telhado enorme viram um prédio grande e compacto com telhado de metal, que parecia uma estação de força, do tamanho de uma estação
de força de uma pequena cidade.
Na extremidade do prédio principal, Thorne viu áreas de carga e descarga e espaços para a manobra de caminhões. A direita, parcialmente escondidas pela folhagem,
havia uma série de estruturas pequenas que pareciam moradias. Mas daquela distância era difícil ter certeza.
No conjunto, todo o complexo tinha uma qualidade utilitária que lembrava um complexo industrial ou uma fábrica. Thorne franziu a testa, tentando identificar
aquilo.
- Você sabe o que é isto? - ele perguntou para Malcolm.
- Sei. - Malcolm balançou a cabeça afirmativamente. - E do que eu suspeitava há algum tempo.

-Sim?
- É uma fábrica - disse Malcolm.
- Mas é enorme - observou Thorne.
- Sim. Tinha de ser. No rádio, Eddie disse:
- Estou ainda pegando o sinal de Levine. E adivinhem! Parece que vem daquele prédio.

Passaram pela entrada coberta do prédio principal, sob o pórtico meio desmoronado. O prédio era de estilo moderno, concreto e vidro, mas há muito tempo tomado
pela selva. Cipós pendiam do teto, os vidros das janelas estavam quebrados, samambaias cresciam entre as rachaduras no concreto.
- Eddie? - disse Thorne. - Tem alguma leitura?
- Tenho. Lá dentro. O que vocês querem fazer?
- Instalar uma base naquele campo lá adiante. - Thorne apontou para uma extensão oitocentos metros à esquerda onde, ao que parecia, tinha existido um vasto
gramado. Formava ainda uma clareira aberta no meio da selva e teriam a luz do sol para as placas fotovoltaicas. - Depois, vamos fazer um reconhecimento.
Eddie estacionou seu Explorer de frente para o lugar de onde tinham vindo. Thorne manobrou o trailer para ficar ao lado do carro, desligou o motor e saltou
para o ar quente e parado da manhã. Malcolm desceu também. Ali, no centro da ilha, o silêncio era completo, exceto pelo zumbido dos insetos.
Eddie se aproximou, dando tapas no rosto e nos braços.
- Grande lugar, hein? Não tem racionamento de mosquitos. Querem apanhar o filho da mãe agora? - Tirou um receptor do cinto e protegeu o visor com a mão em
concha por causa do sol.
- Continua lá. - Apontou para o prédio principal. - O que vamos fazer?
- Vamos apanhá-lo - disse Thorne.
Os três homens entraram no Explorer e, deixando os trailers, seguiram em direção ao prédio gigantesco em ruínas.
O TRAILER

Dentro do trailer já não se ouvia o motor do Explorer e o silêncio era completo. O painel estava aceso, o mapa do GPS visível no monitor, o X piscante marcando
a posição. Uma pequena janela no monitor, intitulada "Sistemas Ativos", indicava as cargas das baterias, a eficiência fotovoltaica e quanto fora usado nas últimas
doze horas. As leituras eletrônicas cintilavam em verde vivo.
Na parte social, onde ficava a cozinha e as camas, o suprimento recirculador de água gorgolejava discretamente. Então alguma coisa caiu com um baque surdo
no compartimento de armazenagem, perto do teto. Outro baque, e depois silêncio.
Depois de um momento, um cartão de crédito apareceu na fenda da porta do compartimento. O cartão deslizou para cima, levantando a lingüeta da fechadura, abrindo-a.
A porta se abriu e um embrulho branco caiu no chão com um ruído surdo. O embrulho rolou e Arby Benton gemeu, esticando o corpo pequeno.
- Se eu não fizer xixi, vou gritar - ele disse, correndo para o banheiro com as pernas bambas.
Suspirou aliviado. A idéia fora de Kelly, mas ela deixou a cargo de Arby os detalhes da aventura. E ele havia planejado tudo com perfeição, pensou Arby -
pelo menos, quase tudo. Tinha previsto corretamente que o frio seria intenso no compartimento de carga do avião e que precisariam se agasalhar. Encheu o compartimento
com todos os cobertores e lençóis que encontrou no trailer. Tinha previsto que ficariam ali pelo menos doze horas e separou alguns biscoitos e garrafas com água.
Na verdade, Arby havia previsto tudo, exceto o fato de que, no último minuto, Eddie Carr entrou no trailer trancando todos os compartimentos por fora. Ficaram presos,
de modo que, durante doze horas, ele não poderia ir ao banheiro. Doze horas!
Suspirou outra vez, livre da tensão. Um fluxo contínuo de urina caía ainda no vaso. Não era para menos! Agonia! E ainda estaria preso lá dentro, pensou Arby,
se não tivesse pensado em...
Ouviu a voz abafada atrás dele. Deu a descarga e voltou, abaixando ao lado do compartimento que ficava debaixo da cama. Abriu a porta rapidamente, outro embrulho
rolou para fora e Kelly apareceu.
- Ei, Kel - disse ele, com orgulho. - Nós conseguimos!
- Eu tenho de ir - ela disse, correndo para o banheiro e fechando a porta.
- Nós conseguimos! - disse Arby. - Estamos aqui!
- Espere um pouco, Arb. Está bem?
Pela primeira vez ele olhou pela janela do trailer. Estavam no meio de uma clareira coberta de relva, e mais além apareciam as samambaias e as árvores altas
da selva. E no alto, acima das copas das árvores, viu a curva da rocha da borda da cratera vulcânica.
Então estavam mesmo na Islã Sorna.
Tudo bem!
Kelly saiu do banheiro.
- Ohhh! Pensei que fosse morrer! - Olhou para ele e ergueu a mão, fazendo um sinal de tudo bem. - A propósito, como conseguiu abrir a porta?
- Cartão de crédito. Kelly franziu a testa.
- Você tem cartão de crédito?
- Meus pais me deram, para alguma emergência. E eu achei que esta era uma emergência. - Tentou levar a coisa na brincadeira, Arby sabia que Kelly era muito
sensível a tudo o que se referia a dinheiro. Estava sempre fazendo comentários sobre as roupas dele e coisas assim. E como Arby sempre tinha dinheiro para o táxi
ou para uma Coca-Cola na Larson's Deli, depois das aulas, e assim por diante. Certa vez Arby disse que não achava que o dinheiro fosse tão importante e Kelly respondeu:
"Por que você ia achar?", com uma voz debochada. Desde então, ele tentava evitar o assunto.

Arby nem sempre tinha certeza do que era melhor fazer ou dizer. Fosse como fosse, todo o mundo o tratava de modo estranho. Porque era pequeno, é claro. Porque
era negro. E porque era o que os outros meninos chamavam de "crânio". Era constante seu esforço para ser aceito, para se encaixar. Mas não conseguia. Não era branco,
não era grande, não era bom em nenhum esporte e não era burro. A maior parte das aulas na escola eram tão tediosas que ele mal conseguia ficar acordado. Os professores
às vezes se aborreciam com ele, mas o que podia fazer? A escola era como um filme em câmera superlenta. Arby podia olhar para eles uma vez de hora em hora que não
perdia nada. E quando estava com os outros meninos, como podia mostrar interesse em programas de televisão? Não podia. Essas coisas não eram importantes.
Mas tinha descoberto há algum tempo que demonstrar desinteresse não contribuía para sua popularidade. O melhor era ficar de boca fechada. Porque ninguém o
compreendia, exceto Kelly. Ela parecia saber do que ele estava falando, a maior parte do tempo.
E o Dr. Levine. Pelo menos a escola tinha uma linha mais avançada que o interessava moderadamente. Não muito interessante, é claro, mas melhor do que as outras.
E quando o Dr. Levine resolveu ensinar na escola, pela primeira vez Arby começou a gostar da escola, de verdade.
- Então esta é a Islã Sorna, hein? - disse Kelly, olhando pela janela, para a selva.
- E. Acho que sim.
- Quando eles pararam aqui na primeira vez, você ouviu o que estavam dizendo?
- Não muito bem, com toda aquela zoeira.
- Eu também não - disse Kelly. - Mas pareciam muito interessados em alguma coisa.
- Sim, pareciam.
- Tive a impressão de que falavam sobre dinossauros - disse Kelly. - Ouviu alguma coisa assim?
Arby riu, balançando a cabeça.
- Não, Kel - ele disse.
- Pois eu acho que estavam.
- Ora, deixa disso, Kel.
Tive a impressão de ouvir falar em "tricerátops".
- Kel - ele disse. - Os dinossauros estão extintos há sessenta e cinco milhões de anos.
- Eu sei...
Arby apontou para a janela.
- Está vendo algum dinossauro lá fora?
Kelly não respondeu. Foi para o outro lado do trailer e olhou pela outra janela. Viu Thorne, Malcolm e Eddie entrando no prédio principal.
- Eles vão ficar danados da vida quando nos encontrarem - disse Arby. - Como acha que devemos dizer que estamos aqui?
- Acho melhor fazer uma surpresa.
- Vão virar fera - disse ele.
- E daí? O que podem fazer? - perguntou Kelly.
- Podem nos mandar de volta.
- Como? Não podem.
- E, acho que não. - Arby deu de ombros fingindo calma, mas estava mais preocupado do que queria admitir. Foi idéia de Kelly. Arby jamais gostou de violar
regras, ou de se meter em encrencas. Nas raras ocasiões em que era repreendido por um professor, ele ficava com calor e começava a suar. E nas últimas doze horas
tinha pensado na reação de Thorne e dos outros.
- Escute - disse Kelly. - O caso é que estamos aqui para ajudar a encontrar nosso amigo, o Dr. Levine, isso é tudo. Nós já ajudamos o Dr. Thorne.
- Sim...
- E vamos poder ajudar outra vez.
- Talvez... - Eles precisam da nossa ajuda.
- Talvez - repetiu Arby, sem convicção.
- O que será que eles têm para comer por aqui? - disse Kelly, abrindo a geladeira. - Está com fome?
- Morrendo - disse Arby, descobrindo de repente que era verdade.
- Então, o que você quer?
- O que tem aí? - Sentou no sofá cinzento e recostou, enquanto Kelly revistava a geladeira.
- Venha ver - ela disse, aborrecida* - Eu não sou sua empregada babaca.
- Tudo bem, tudo bem, fica fria.
- Ora, você espera ser servido por todo o mundo - disse ela.
- Não é verdade. - Arby levantou rapidamente do sofá.
- Arby, você é mesmo um pirralho malcriado.
- Ei, qual é o problema? Fica fria. Está nervosa com alguma coisa?
- Não, não estou. - Apanhou um sanduíche embrulhado. Ao lado dela, Arby olhou rapidamente para dentro da geladeira
e apanhou o primeiro sanduíche que viu.
- Você não quer isso - disse Kelly.
- Sim, eu quero.
- E salada de atum.
Arby detestava salada de atum. Pôs o sanduíche na geladeira e olhou outra vez.
- Aqueles da esquerda são de peru - ela disse. - Com pão doce.
Arby apanhou um sanduíche de peru.
- Obrigado.
- Tudo bem. - Kelly sentou no sofá, desembrulhou o sanduíche e comeu avidamente.
- Escute, pelo menos eu consegui que chegássemos aqui - ele disse, desembrulhando o sanduíche cuidadosamente. Dobrou o plástico e o pôs de lado.
- Sim, você conseguiu. Eu admito. Fez muito bem essa parte. Arby pensou que jamais havia comido uma coisa tão deliciosa
em toda a sua vida. Era melhor até do que os sanduíches de peru que sua mãe fazia.
Ao lembrar da mãe, sentiu um aperto no estômago. Ela era ginecologista e muito bonita. Levava uma vida intensa e quase nunca estava em casa, mas, quando estava,
sempre parecia extremamente tranqüila. E Arby sentia-se tranqüilo perto dela. Os dois tinham um relacionamento muito especial, mas ultimamente às vezes ela parecia
preocupada com quanto ele sabia. Uma noite ele entrou no estúdio dela e a encontrou lendo alguns artigos sobre os níveis de progesterona e FSH. Ele olhou por cima
dos ombros dela para as colunas de números e sugeriu que ela devia tentar a equação não-linear para analisar os dados. Ela olhou para ele de modo estranho, distante
e pensativamente, e naquele momento Arby sentiu...
- Vou comer outro - Kelly disse, voltando para a geladeira e pegando dois sanduíches, um em cada mão.
- Acha que tem o bastante para todos?
- Quem se importa? Estou morrendo de fome - disse ela, rasgando o plástico de um deles.
- Talvez a gente não deva comer...
- Arb, se era para você ficar preocupado desse jeito, devíamos ter ficado em casa.
Arby resolveu que ela estava certa. Com surpresa viu que tinha comido todo o sanduíche e apanhou o que Kelly oferecia. Kelly comeu olhando pela janela.
- O que será aquele prédio onde eles entraram? Parece abandonado.
- E. Há anos.
- Por que alguém ia construir tudo isso aqui, nesta ilha deserta da Costa Rica?
- Talvez estivessem fazendo alguma coisa secreta.
- Ou perigosa - disse ela.
- E. Ou isso. - A idéia de perigo era ao mesmo tempo excitante e desanimadora. Arby estava se sentindo muito longe de casa.
- O que será que estavam fazendo? - Ainda comendo, Kelly levantou e foi para a janela. - É mesmo um lugar enorme. Nossa. Que coisa esquisita.
- O quê?
- Venha ver. Aquele prédio está todo coberto de mato, como se há anos não fosse ocupado. E este campo também está com a relva alta demais.
- Sim.
- Mas aqui embaixo - ela disse, apontando para perto do trailer - estou vendo uma trilha limpa.
Mastigando, Arby olhou. Sim, era verdade. A poucos metros do trailer, a relva estava amassada e amarelada. Em vários lugares aparecia terra. Era uma trilha
estreita mas distinta que ia para a direita, atravessando a clareira.
- Então - disse Kelly. - Se não vem ninguém aqui há anos, o que foi que fez essa trilha?
- Só pode ser algum animal - disse ele. Não podia pensar em outra coisa. - Deve ser uma trilha de animais.
- Que animais?
- Eu não sei. O que tiver por aqui. Gamos ou coisa assim.
- Não vi nenhum gamo. Ele deu de ombros.
- Talvez cabras. Você sabe, cabras selvagens, como as que há no Havaí.
- A trilha é larga de mais para ser de cabras.
- Talvez um rebanho inteiro de cabras selvagens.
- Larga de mais - repetiu Kelly. Deu de ombros e se afastou da janela, voltando para a geladeira. - Vou ver se há alguma sobremesa.
Quando ela falou em sobremesa, Arby teve uma idéia. Foi até o compartimento acima da cama, subiu e começou a procurar.
- O que está fazendo? - perguntou Kelly.
- Verificando a minha mochila.
- Procurando o quê?
- Acho que esqueci a escova de dentes.
- E daí?
- Não vou poder escovar os dentes.
- Arb, quem se importa com isso?
- Mas eu sempre escovo os dentes...
- Tenha coragem - disse Kelly. - Viva um pouco.
Arby suspirou.
- Talvez o Dr. Thorne tenha trazido uma escova extra. - Sentou no sofá ao lado de Kelly.
Ela cruzou os braços e balançou a cabeça.
- Nenhuma sobremesa?
- Nada. Nem iogurte congelado. Adultos. Nunca planejam as coisas direito.
- Sim, é verdade.
Arby bocejou. Estava quente no trailer, e ele começava a sentir sono. Nas doze horas que passou naquele compartimento, não conseguiu dormir, tremendo de frio
e quase sem poder se mexer. Agora sentia cansaço.
Olhou para Kelly e ela bocejou também.
- Quer ir lá fora? Para espantar o sono?
- Acho melhor esperarmos aqui - disse ele.
- Se eu ficar aqui, acho que vou dormir.
Arby deu de ombros. O sono estava chegando depressa. Voltou para a parte social do trailer e deitou no colchão debaixo da janela. Kelly foi atrás.
- Eu não vou dormir - ela disse.
- Ótimo, Kel. - Os olhos dele estavam pesados. Não dava mais para mantê-los abertos.
- Mas - ela bocejou outra vez - acho que vou deitar um pouco, por alguns minutos.
Arby a viu deitar na outra cama, os olhos dele se fecharam e ele adormeceu. Sonhou que estava outra vez no avião, sentindo o balanço suave, ouvindo o ronco
abafado dos motores. Seu sono era leve e em dado momento acordou e podia jurar que o trailer estava balançando e que realmente um ronco surdo parecia vir da janela.
Mas voltou a dormir quase imediatamente e dessa vez sonhou com dinossauros. Os dinossauros de Kelly. E no seu sonho leve havia dois animais, tão grandes que não
dava para ver as cabeças deles da janela, só as pernas grossas e cobertas de escamas passando, com passos pesados pelo trailer. Mas no sonho o segundo animal parou
e se inclinou, a cabeça enorme espiou com curiosidade para dentro do trailer, e Arby compreendeu que estava vendo a cabeça gigantesca de um tiranossauro rex, as
mandíbulas enormes abrindo e fechando, os dentes brancos brilhando à luz do sol, e no seu sonho ele viu tudo isso calmamente e voltou a dormir.

INTERIOR


Duas portas grandes de vaivém na frente do prédio levavam a um saguão escuro. O vidro estava arranhado e sujo, as maçanetas cromadas da porta, manchadas de
ferrugem. Mas o arco formado na poeira, nos escombros e nas folhas secas, no chão, indicava que a porta fora aberta recentemente.
- Alguém abriu esta porta há pouco tempo - disse Eddie.
- Sim - disse Thorne. - Alguém com botas Asolo. - Ele abriu mais a porta. - Vamos entrar?
No interior do prédio o ar era quente, parado e malcheiroso. O saguão era pequeno e simples. Um balcão de recepção, bem na frente da porta, devia ter sido
antes coberto com tecido de cor cinza, agora substituído por uma camada escura que parecia líquen. Na parede atrás do balcão, letras cromadas diziam: "Nós Fazemos
o Futuro", mas as palavras estavam escondidas entre trepadeiras enlaçadas. Cogumelos e fungos cresciam no carpete. A direita viram a sala de espera com uma mesa
de centro e dois sofás compridos.
Um dos sofás tinha manchas de bolor espesso e marrom, o outro estava coberto por um plástico. Perto desse sofá estava o que havia sobrado da mochila verde
de Levine, com o tecido todo rasgado. Na mesa estavam duas garrafas de plástico de Evian, vazias, um telefone-satélite, um short enlameado e várias pedaços de papel
amassados de barras de chocolate. Uma cobra verde atravessou a sala quando eles entraram.
- Então este é o prédio da InGen? - disse Thorne, olhando para as letras na parede.
- Sem dúvida nenhuma - disse Malcolm.
Eddie abaixou e passou a mão pelos cortes no tecido da mochila de Levine. Um rato enorme saltou de dentro.
- Jesus!
O rato fugiu, guinchando. Eddie olhou cautelosamente dentro da sacola.
- Acho que ninguém vai querer o que restou das barras de chocolate - ele disse. Examinou a pilha de roupas. - Está recebendo alguma coisa disto aqui? - Algumas
peças de roupa para expedição tinham microssensores costurados nelas.
- Não - disse Thorne, movimentando seu monitor manual. - Tenho alguma coisa... mas parece vir dali.
Apontou para um conjunto de portas de metal além do balcão, que davam para o resto do prédio e que antigamente eram fechadas com cadeados enferrujados. Mas
agora os cadeados estavam no chão, quebrados.
- Vamos encontrá-lo - disse Eddie, dirigindo-se para as portas. - Que tipo de cobra acham que era aquela?
- Eu não sei.
- Era venenosa?
- Não sei.
As portas se abriram com um rangido. Os três homens entraram num corredor com janelas quebradas numa das paredes e folhas secas e entulho no chão. As paredes
estavam sujas e manchadas em vários lugares do que parecia sangue seco. Viram várias portas que davam para o corredor. Nenhuma parecia estar trancada.
Plantas cresciam entre os rasgos do carpete. Perto das janelas, onde havia luz, trepadeiras cresciam viçosas sobre as paredes rachadas. Mais trepadeiras pendiam
do teto. Os três seguiram pelo corredor. Só se ouvia o ruído dos seus passos amassando as folhas secas.
- Está ficando mais forte - disse Thorne, olhando para o monitor. - Ele deve estar em algum lugar neste prédio.
Thorne abriu a primeira porta e viu um escritório simples com uma mesa, uma cadeira, o mapa da ilha na parede. Uma luminária de mesa caída sob o peso das
trepadeiras. Um monitor de computador com uma camada fina de bolor. Na outra extremidade da sala a luz filtrava através da janela cinzenta.
Seguiram para a segunda porta e viram um escritório quase idêntico, mesa e cadeira iguais, janelas iguais na extremidade da sala.
Eddie resmungou:
- Parece que estamos no prédio de escritórios.
Thorne continuou a andar. Abriu a terceira porta e depois a quarta. Mais escritórios.
Thorne abriu a quinta porta e parou.
Ele estava numa sala de conferências, muito suja, com entulhos e folhas. Havia fezes de animais na longa mesa de madeira no centro da sala. A janela estava
imunda. Thorne aproximou-se do mapa enorme que cobria toda uma parede da sala de conferências. Viu alfinetes de várias cores no mapa. Eddie chegou perto também e
franziu a testa.
Abaixo do mapa havia um armário com gavetas. Thorne tentou abrir, mas estavam todas trancadas. Malcolm caminhou lentamente pela sala, observando tudo com
atenção.
- O que significa este mapa? - perguntou Eddie. - Tem alguma idéia do que indicam esses alfinetes?
Malcolm olhou para o mapa.
- Vinte alfinetes em quatro cores diferentes. Cinco de cada cor. Dispostos num pentagrama, ou pelo menos num padrão de cinco pontas, dirigidos a todas as
partes da ilha. Eu diria que parece uma rede.
- Arby não disse que havia uma rede nesta ilha?
- Sim, ele disse... Interessante...
- Bem, vamos deixar isso agora - disse Thorne. Voltou para o corredor, seguindo o sinal da sua unidade manual. Malcolm saiu, fechou a porta, e eles continuaram
pelo corredor, seguindo o sinal de Levine.
No fim do corredor havia duas portas de correr onde estava escrito ENTRADA PERMITIDA SOMENTE A PESSOAL AUTORIZADO. Thorne espiou pelo vidro, mas não dava
para ver muita coisa. Teve a impressão de um vasto espaço e maquinário complexo, mas o vidro tinha linhas espessas de sujeira. Era difícil ver lá dentro.

- Você acha mesmo que sabe para que servia este prédio? - ele perguntou a Malcolm.
- Eu sei exatamente para que era - respondeu Malcolm. - É uma fábrica de dinossauros.
- Para que alguém ia querer fazer isso? - perguntou Eddie.
- Ninguém queria - disse Malcolm. - Por isso eles guardaram segredo.
- Eu não entendo - disse Eddie. Malcolm sorriu.
- E uma longa história.
Tentou abrir as portas, mas não conseguiu. Ele fez mais força. E então, de repente, com um rangido metálico, elas correram para os lados.
Eles entraram na área escura.

As lanternas mostravam um corredor completamente escuro.
- Para compreender este lugar, é preciso retroceder dez anos, para um homem chamado John Hammond e um animal chamado quaga.
- Chamado o quê?
- O quaga - disse Malcolm - é um animal africano, parecido com a zebra. Foi extinto no século passado. Mas na década de 1980 alguém usou as técnicas mais
avançadas de extração do DNA num pedaço de pele de quaga e conseguiu retirar uma grande quantidade de DNA. Tanta que começaram a falar em trazer o quaga de volta
à vida. E se podiam trazer o quaga, por que não outros animais extintos? O dodô? O tigre dente-de-sabre? Ou até mesmo os dinossauros?
- Onde iam arranjar o DNA de um dinossauro? - perguntou Thorne.
- Na verdade - disse Malcolm -, os paleontólogos há anos vêm encontrando fragmentos de dinossauros. Nunca falaram muito a respeito porque jamais tiveram material
suficiente para usar como um instrumento de classificação. Desse modo, não tinham nenhum valor, eram apenas uma curiosidade.
- Mas para recriar um animal é necessário mais do que fragmentos de DNA - disse Thorne. - É preciso toda a espiral.
- Certo - disse Malcolm. - E o homem que descobriu um meio de fazer isso era um capitalista chamado John Hammond. Seu raciocínio era que, quando os dinossauros
estavam vivos, provavelmente eram picados por insetos que sugavam seu sangue, como os insetos de hoje. E alguns desses insetos mais tarde pousariam num galho e ficariam
presos na seiva pegajosa. E alguma parte dessa seiva se solidificaria, transformando-se em âmbar. Hammond resolveu que, se retirassem os insetos preservados no âmbar
e extraíssem o conteúdo dos seus estômagos, acabariam conseguindo um pouco de DNA de dinossauros.
- E ele conseguiu?
- Sim. Ele conseguiu. E fundou a InGen para desenvolver essa descoberta. Hammond era um aventureiro e seu talento verdadeiro era para conseguir dinheiro.
Ele descobriu um meio de levantar fundos suficientes para pesquisa, com o objetivo de, partindo do DNA, chegar a uma animal vivo. As fontes patrocinadoras não apareceram
imediatamente porque, embora fosse estimulante a idéia de recriar um dinossauro, não era exatamente a cura do câncer.
"Então ele resolveu criar uma atração turística. Construiu seu parque numa ilha chamada Islã Nublar, ao norte daqui, e planejou abri-lo ao público em fins
de 1989. Eu visitei o parque um pouco antes da data marcada para a abertura. Mas aconteceu que Hammond teve problemas", continuou Malcolm. "Os sistemas de segurança
do parque enguiçaram e os dinossauros ficaram livres. Alguns visitantes foram mortos. Depois disso, o parque e todos os dinossauros foram destruídos."
Passaram por uma janela por onde podiam ver, na planície, o bando de dinossauros pastando na margem do rio. Thorne perguntou.
- Se foram todos destruídos, o que há nesta ilha?
- Esta ilha - disse Malcolm - é o pequeno segredo sujo de Hammond. E a face oculta do seu parque.
Continuaram a andar no corredor.
- Acontece - disse Malcolm - que na Islã Nublar mostravam aos visitantes um impressionante laboratório de genética, com computadores e seqüenciadores de genes
e todo tipo de equipamento para chocar e criar pequenos dinossauros. Diziam que os dinossauros eram criados ali mesmo, no parque. E a visita ao laboratório era muito
convincente.
"Mas na verdade, vários processos não constavam do roteiro dos visitantes. Numa sala ele mostrava o DNA do dinossauro sendo extraído. Na sala seguinte, mostrava
os ovos prontos para abrir. Era muito dramático, mas como ele havia passado do DNA para o embrião viável? Ninguém jamais viu essa fase crítica. Do modo como tudo
era apresentado, simplesmente tinha acontecido, entre uma sala e outra.
"O fato é que todo o show de Hammond era bom demais para ser verdade. Por exemplo, ele tinha uma chocadeira onde os pequenos dinossauros saíam dos ovos, enquanto
os visitantes olhavam maravilhados. Mas nunca houve nenhum problema na chocadeira. Nenhum natimorto, nenhuma deformidade, nenhuma dificuldade de qualquer tipo. Na
apresentação de Hammond, essa tecnologia assombrosa era processada sem nenhum obstáculo.
"E, pensando bem, isso não era possível. Hammond afirmava que fabricava animais extintos usando uma tecnologia inovadora. Porém, com qualquer nova tecnologia
de fabricação, o produto inicial é escasso, na ordem de um por cento, ou menos. Sendo assim, de fato Hammond devia criar milhares de embriões de dinossauros para
conseguir um único vivo. Isso implicava uma gigantesca operação industrial, não o pequeno e imaculadamente limpo laboratório que ele mostrava."
- Quer dizer, isto aqui - disse Thorne.
- Sim. Aqui, em outra ilha, em segredo, longe da curiosidade do público, Hammond estava livre para fazer a pesquisa e trabalhar com a verdade desagradável
disfarçada pelo belo e pequeno parque. O pequeno zoológico genético de Hammond era uma vitrine. Mas esta ilha era a coisa real. Era aqui que os dinossauros eram
feitos.
- Se os animais no zoológico foram destruídos - disse Eddie -, como não foram destruídos os desta ilha também?
- Uma boa pergunta - disse Malcolm. - Saberemos a resposta dentro de alguns instantes. - Iluminou o túnel com a lanterna e a luz refletiu nas paredes de
vidro. - Porque, se não estou enganado, a primeira unidade de fabricação está logo adiante.

ARBY


Arby acordou e sentou na cama, piscando os olhos para a luz da manhã, que entrava pelas janelas do trailer. Na outra cama, Kelly dormia ainda, roncando alto.
Ele olhou pela janela para a entrada do prédio grande e viu que os adultos tinham desaparecido. O Explorer estava parado na entrada, mas não havia ninguém
dentro. O trailer estava isolado na clareira de relva alta. Arby sentiu-se completamente sozinho - assustadoramente sozinho -, e uma sensação de pânico acelerou
seu coração. Não devia ter vindo, pensou. Foi uma idéia idiota. E, o pior de tudo, planejada por ele. Foi ele quem pensou em se esconder no trailer, depois foram
ao escritório de Thorne. E Kelly falou com Thorne enquanto Arby roubava a chave. Foi ele quem pensou na mensagem de rádio intencionalmente retardada, para que Thorne
pensasse que estavam ainda em Woodside. Na hora, Arby achou que estava sendo muito esperto, mas agora estava arrependido. Resolveu chamar Thorne imediatamente. Precisava
se entregar. Estava dominado por um desejo inabalável de confessar.
Precisava ouvir a voz de alguém. Essa era a verdade.
Foi para a frente do trailer e ligou a chave no painel. Apanhou o fone do rádio e disse:
- Aqui fala Arby. Tem alguém aí? Câmbio. Aqui fala Arby.
Mas ninguém respondeu. Depois de um momento, ele olhou para o monitor do sistema no painel que registrava todos os sistemas que estavam em operação. Não viu
nada sobre comunicações. Lembrou então que o sistema de comunicação provavelmente estaria ligado ao computador e resolveu tentar.
Voltou para o centro do trailer, apanhou o teclado e ligou o computador. Havia uma mensagem que dizia "Sistemas de Campo Thorne". E logo abaixo, uma lista
dos subsistemas no interior do trailer. Um deles era de radiocomunicação. Arby clicou e entrou no sistema.
A tela do computador mostrou um desenho confuso de estática. Na parte inferior um comando dizia Inputs de Freqüência Múltipla Recebidos. Você quer Autotune?
Arby não sabia o que era isso, mas com computadores ele era destemido. Autotune parecia interessante. Sem hesitar, escreveu "Sim".
O desenho da estática continuou na tela, enquanto números passavam na parte inferior. Arby achou que estava vendo as freqüências em megahertz. Mas não tinha
certeza.
Então, de repente, a tela ficou vazia, exceto por uma única palavra que piscava no canto superior esquerdo:
LOGIN
Arby franziu a testa, pensando. Estranho. Aparentemente o estavam convidando para entrar no sistema de computador do trailer. Isso queria dizer que ia precisar
de uma senha. Ele tentou THORNE.
Não aconteceu nada.
Esperou um pouco, depois tentou as iniciais de Thorne: JT
Nada.
LEVINE.
Nada.
SISTEMAS DE CAMPO THORNE.
Nada.
SCT.
Nada. CAMPO. Nada. USUÁRIO. Nada.
Bem, pensou ele, pelo menos o sistema não o pôs para fora. A maioria dos sistemas rejeita o pedido depois de três tentativas. Mas aparentemente Thorne não
havia encaixado nenhum tipo de segurança no seu sistema. Arby jamais o faria assim. Era um sistema por demais paciente e pronto para servir.
Ele tentou: HELP.
O cursor moveu-se para outra linha. Uma pausa, e os drives zumbiram.
- Ação - Arby disse, esfregando as mãos.

LABORATÓRIO


Quando seus olhos ajustaram-se à pouca luz, Thorne viu que estavam num espaço enorme com filas e mais filas de caixas de aço inoxidável, cada uma com um labirinto
de tubos de plástico. Tudo estava coberto de poeira e muitas das caixas caídas.
- Na primeira fila - disse Malcolm - estão os seqüenciadores de genes Nishihara. E logo em seguida, os sintetizadores automáticos de DNA.
- É uma fábrica - disse Eddie. - Como uma usina agrícola ou coisa parecida.
- Sim, isso mesmo.
No canto da sala estava uma impressora com algumas folhas soltas de papel amarelado ao lado. Malcolm apanhou uma delas.

[GALRERYF1] Fator de transcrição eritróide-específico de Gallimimus eryl f1 mRNA, cods. completo. |GALRERYF1 1068 bp ss-mRNA VRT 15-dez-1989] SOURCE (SRC)
Gallimimus bullatus (macho) sangue embriônico 9 dias, cDNA
para mRNA, clone E120-1.
ORGANISMO Gallimimus bullatus
Animalia; Chordata, Vertebrata; Archosauria; Dinosauria: Ornithomimisauria.
REFERÊNCIA [REF]
1 (BASES 1 A 1418) T.R. Evans, 17-jul- 1989. CARACTERÍSTICAS [FEA]
Localização/ Qualificadores
/nota= "Eryfl proteína gi: 212629"
/codon start=1
/tradução="MEFVALGGPDAGSPTPFPDEAGAFLGLGGGERTEAGGLLASYPPGRVSLVPWADTGTLGTPQWVPPATQMEPPHYLELLQPPRGSPPHPSSGPLLPLSSGPPPCEARECVNCGATATPLWRRDGTGHYLCNACGLYHRLNGQNRPLIRPKKRLLVSKRAGTV


CSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSSKGKKRRPPGGGNPSATAGGGAPMGGGGDPSMPPPPPPPAAAPPQSDALYALGPVVLSGHFLPFGNSGFFGGGAGGYTAPPGLSPQI"
BASE COUNT [BAS]
206 a 371 c 342 g 149 t

- É uma referência ao banco de dados de um computador - disse Malcolm. - Para o fator sangüíneo de algum dinossauro. Algo a ver com os glóbulos vermelhos.
- E a seqüência é essa?
- Não. - Malcolm começou a examinar os papéis. - Não, a seqüência devia ser uma série de nucleotídeos... Aqui está.
Apanhou outra folha de papel.

SEQÜÊNCIA

1
GAATTCCGGA
AGCGAGCAAG
AGATAAGTCC
TGGCATCAGA
TACAGTTGGA
GATAAGGACG
61
GACGTGTGGC
AGCTCCCGCA
GAGGATTCAC
TGGAAGTGCA
TTACCTATCC
CATGGGAGCC
121
ATGGAGTTCG
TGGCGCTGGG
GGGGCCGGAT
GCGGGCTCCC
CCACTCCGTT
CCCTGATGAA
181
GCCGGAGCCT
TCCTGGGGCT
GGGGGGGGGC
GAGAGGACGG
AGGCGGGGGG
GCTGCTGGCC
241
TCCTACCCCC
CCTCAGGCCG
CGTGTCCCTG
GTGCCGTGGG
CAGACACGGG
TACTTTGGGG
301
ACCCCCCAGT
GGGTGCCGCC
CGCAACCCAA
ATGGAGCCCC
CCCACTACCT
GGAGCTGCTG
361
CAACCCCCCC
GGGGCAGCCC
CCCCCATCCC
TCCTCCGGGC
CCCTACTGCC
ACTCAGCAGC
421
GGGCCCCCAC
CCTGCGAGGO
CCGTGAGTGC
GTCATGGCCA
GGAAGAACTG
CGGAGCGAGC
481
GCAACGCCGC
TGTGGCGCCG
GGACGGCACC
GGGCATTACC
TGTGCAACTG
GGCCTCAGCC
541
TGCGGGCTCT
ACCACCGCCT
CAACGGCCAG
AACCGCCCGC
TAATCCGCCC
CAAAAAGCGC
601
CTGCTGGTGA
GTAAGCGCGC
AGGCACAGTG
TGCAGCCAGC
AGCGTGAAAA
CTGCCAGACA
661
TCCACCACCA
CTCTGTGGCG
TCGCAGCCCC
ATGGGGGACC
CCGTCTGCAA
CAACATTCAC
721
CGCTGCGGCC
TCTACTACAA
ACTGCACCAA
GTGAACCGCC
CCCTCACGAT
GCGCAAAGAC
781
GGAATCCAAA
CCCGAAACCG
CAAAGTTTCC
TCCAAGGGTA
AAAAGCGCGG
CCCCCCGGGG
841
GGGGAAACC
CCTCCGCCAC
CGCGGGAGGG
GGCGCTCCTA
TGGGGGGAGG
GGGGGACCCC
901
TCTATGCCCC
CCCCGCCGCC
CCCCCCGGCC
GCCGCCCCCC
CTCAAAGCGA
CGTCCTGTAC
961
GCTCTCGGCC
CCGTGGTCCT
TTCGGGCCAT
TTTCTGCCCT
TTGGAAACTC
GCGAGGGTTT
1021
TTTGGGGGGG
GGGCGGGGGG
TTACACGGCC
CCCCCGGGGC
TGAGCCCGCA
GATTTAAATA
1081
ATAACTCTGA
CGTGGGCAAG
TGGGCCTTGC
TGAGAAGACA
GTGTAACATA
ATAATTTGCA
1141
CCTCGGCAAT
TGCAGAGGGT
CGATCTCCAA
TTTGGACACA
ACAGGGCTAC
TCGGTAGGAC
1201
CAGATAAGCA
CTTTGCTCCC
TGGACTGAAA
AAGAAAGGAT
TTATCTGTTT
GOTTCTTGCT
1261
GACAAATCCC
TGTGAAAGGT
AAAAGTCGGA
CACAGCAATC
GATTATTTCT
GGCCTGTGTG
1321
AAATTACTGT
GGAATATTGTA
AATATATATA
TATATATATA
TATATCTGTA
TAGAACAGCC
1381
TCGGAGGCGG
CATGGACCCA
GCGTAGATCA
TGCTGGATTT
GTACTGCCGG
AATTC

Distribuição [DIS]
Wu /HQ-Ops
Loru Ruso /Prod
Chang /89 Pen
NOTA PRODUÇÃO [PNOTA]
Seqüência final aprovada.

- Isso tem alguma coisa a ver com o motivo da sobrevivência dos animais? - perguntou Thorne.
- Não tenho certeza - disse Malcolm. Essas anotações teriam relação com os últimos dias da fábrica? Ou seriam apenas algo impresso há muitos anos e deixado
para trás?
Procurou em volta da impressora e achou uma prateleira com pilhas de folhas impressas. Examinou-as. Eram memorandos em papel azul desbotado e todos breves.

De: CC/D-P Jenkins Para:H.Wu
Excesso de dopamina em Alfa5 significa que o receptor Dl ainda não está funcionando com a agilidade desejada. Para minimizar o comportamento agressivo nos
organismos acabados, devemos tentar heranças genéticas alternadas. Precisamos começar isso hoje.

E outro:

De: CC/D Para: H. Wu/Sup
O glicogênio sintase quinase-3 isolado do Xenopus pode funcionar melhor do que o GSK-3 alfa-beta de mamíferos atualmente em uso.
Devemos esperar o estabelecimento mais robusto de polaridade dorso-ventral e menor desgaste no embrião. Concorda?

Malcolm leu o seguinte:

De: Backes Para: H. Wu/Sup
Fragmentos curtos de proteína podem estaragindo como príons. Origem duvidosa, mas sugere a cessação de todas as proteínas exógenas para organ. carn. até descobrira
origem. A doença não pode continuar!

Thorne olhou para trás e observou.
- Parece que eles tinham problemas.
- Sem dúvida - disse Malcolm. - Seria impossível não ter. Mas a questão é...
Não terminou a frase; olhava para o memorando seguinte, que era mais longo.

ATUALIZAÇÃO PRODUÇÃO INGEN 10/10/88
De: Lori Ruso Para: Todo o pessoal
Assunto: Baixa produção

Episódios recentes de perda de nascimentos bem-sucedidos no período de 24-72 horas depois da abertura do ovo foram identificados como resultantes de contaminação
pela bactéria Escherichia coli.
Essa contaminação provocou um corte de 60% na produção e provém de esterilização inadequada do pessoal, principalmente durante o processo H (Fase de manutenção
do ovo, Reforço hormonal 2G/H).
Os braços articulados dos komera foram reinstalados e recobertos em robôs 5A e 7D, mas a reposição diária da agulha ainda é necessária, de acordo comas condições
de esterilização (Manual Geral: Diretriz 5-9).
Durante o próximo ciclo de produção (12/10 - 26/10) sacrificaremos cada décimo ovo na Fase H para testes de contaminação. Comecem a separá-los imediatamente.
Comuniquem todos os erros. Interrompam a linha sempre que necessário até o problema ser resolvido.


- Tiveram problemas com infecção e contaminação na linha de produção - disse Malcolm. - E talvez com outras fontes de contaminação. Veja isto.
Entregou a Thorne o memorando seguinte.

ATUALIZAÇÃO PRODUÇÃO INGEN 18/12/88
De: H. Wu
Para: Todo o pessoal
Assunto: DX: ETIQUETA E LIBERAÇÃO

Os nascidos com vida receberão as novas etiquetas de campo
Grumbach no primeiro intervalo viável. A alimentação já não
será ministrada dentro do laboratório. O programa de liberação
está agora em plena operação e as redes de rastreamento são
ativadas para o monitor.

Thorne disse:
- Isto significa o que estou pensando?
- Sim - disse Malcolm. - Estavam tendo problemas para manter vivos os recém-nascidos, então eles os etiquetaram e os libertaram.
- E os rastrearam por meio de um tipo de rede?
- Sim. Acho que sim.
- Eles soltaram dinossauros nesta ilha? - perguntou Eddie. - Deviam estar loucos.
- Desesperados, parece ser a palavra certa - disse Malcolm. - Imaginem a cena. Este processo imenso e caro de alta tecnologia, e no fim os animais estão adoecendo
e morrendo. Hammond deve ter ficado furioso. Então, resolveram tirar os animais do laboratório e soltá-los na selva.
- Mas por que não descobriram a causa da doença, por que eles não...
- Processo comercial - disse Malcolm. - O ponto central são os resultados. Estou certo de que pensaram que, rastreando os animais, podiam trazê-los de volta
a qualquer momento. E, não esqueça, pode ter funcionado. Devem ter soltado os animais e os recolheram, depois de algum tempo, quando estavam mais velhos, enviando-os
para o zoológico de Hammond.
- Mas não todos...
- Não sabemos de tudo ainda - disse Malcolm. - Não sabemos o que aconteceu aqui.
Passaram para a sala seguinte, pequena e quase vazia, com um banco no centro e armários fechados nas paredes. Os avisos diziam
OBSERVEM AS PRECAUÇÕES DE ESTERILIZAÇÃO E MANTENHAM OS PADRÕES SK4. Na extremidade da sala havia um conjunto de armários com pilhas de aventais e gorros amarelados.
Eddie disse:
- E o vestiário.
- Sim, parece que é. - Malcolm abriu um dos armários. Estava vazio, a não ser por um par de sapatos de homem. Abriu vários outros. Todos vazios. Num dos
lados de um deles havia um papel pregado.

A Segurança é do Interesse de Todos!
Comunique Anomalias Genéticas!
Inutilize o Lixo Biológico Adequadamente!
Detenha a Disseminação do DX Agora!

- O que é DX? - quis saber Eddie.
- Eu acho - respondeu Malcolm - que é o nome da doença misteriosa.
Na extremidade da sala havia duas portas. A da direita era pneumática, operada por um painel com base de borracha preso no chão, por isso eles usaram a da
esquerda, que se abriu com facilidade.
Entraram num longo corredor, com painéis de vidro do chão ao teto na parede da direita. O vidro estava arranhado e sujo, mas através dele dava para ver a
sala ao lado, diferente de tudo o que Thorne já havia visto.
Era um espaço enorme, do tamanho de um campo de futebol. Correias transportadoras cruzavam a sala em dois níveis, um muito alto, o outro na altura da cintura.
Em vários pontos da sala havia conjuntos de máquinas muito grandes com tubulação complexa e braços móveis, ao lado das correias.
Thorne iluminou as correias com a lanterna.
- Uma linha de montagem - disse ele.
- Mas parece que nunca foi usada, como se estivesse pronta para funcionar - observou Malcolm. - Lá adiante há algumas plantas crescendo do chão, mas o resto
está extremamente limpo.
- Limpo demais - disse Eddie. Thorne deu de ombros.
- Se for uma sala de ambiente limpo, provavelmente é hermeticamente fechada - disse ele. - Acho que permaneceu exatamente como era anos atrás.
Eddie balançou a cabeça.
- Durante anos? Acho que não, Thorne.
- Então como explica isso?
Malcolm franziu a testa, espiando pelo vidro. Como era possível uma sala daquela tamanho permanecer limpa depois de tantos anos? Não fazia...
- Ei! - Eddie exclamou.
Malcolm viu também. Uma pequena caixa azul no canto da sala, entre o chão e o teto com cabos ligados a ela. Obviamente um tipo de caixa de ligação elétrica.
Uma pequena luz vermelha estava acesa na caixa.
- Este lugar tem energia!
Thorne chegou mais perto do vidro e olhou para a sala.
- Isso é impossível. Deve ser um tipo de carga armazenada ou uma bateria...
- Depois de cinco anos? Nenhuma bateria dura tanto tempo - disse Eddie. - Estou dizendo, Thorne, este lugar tem eletricidade!

Arby olhava para o monitor, lendo as letras brancas que apareciam na tela:
É A PRIMEIRA VEZ QUE VOCÊ USA A REDE?
Ele gritou:
SIM.
Outra pausa. Ele esperou. Mais letras apareceram lentamente.
SEU NOME COMPLETO.
Ele escreveu seu nome.
DESEJA UMA SENHA INDIVIDUAL?
Está brincando, pensou ele. Aquilo ia ser canja. Quase não tinha graça. O Dr. Thorne devia ter sido mais esperto. Escreveu:
SIM.
Depois de um momento:
SUA NOVA SENHA É VTG/&*849/. POR FAVOR, ANOTE.
Claro, pensou Arby. Pode apostar. Não havia nenhum papel na mesa. Arby procurou nos bolsos, encontrou um pedaço de papel e escreveu a senha.
POR FAVOR, DIGITE SUA SENHA AGORA.
Ele digitou as letras e os números.
Outra pausa e então mais letras começaram a aparecer na tela, em ritmo estranhamente lento, com paradas ocasionais. Depois de todo esse tempo, talvez o sistema
não estivesse funcionando muito...
OBRIGADO. SENHA CONFIRMADA.
A tela piscou e de repente ficou azul-escura. Soou uma campainha eletrônica.
E então o queixo de Arby caiu. Estava escrito na tela.

INTERNATIONAL GENETICS TECHNOLOGIES
SÍTIO B
SERVIÇO DE REDE LOCAL

Não tinha sentido. Como podia haver uma rede no Sítio B? A InGen havia fechado o Sítio B há muitos anos, de acordo com os documentos encontrados. A InGen
estava fechada, há muito tempo falida. Que rede? E como tinha conseguido entrar nela? O trailer não estava ligado a coisa alguma. Não havia cabos nem nada. Então
devia ser uma rede de rádio, já existente na ilha. De algum modo ele tinha conseguido entrar nela. Mas como essa rede podia existir? Uma rede de rádio precisa de
eletricidade e não havia eletricidade na ilha.
Arby esperou.
Não aconteceu nada. As palavras ficaram paradas na tela. Ele esperou o menu, mas este não apareceu. Arby começou a pensar que talvez o sistema estivesse desativado.
Ou desligado. Deixava apenas a pessoa entrar, mas não acontecia mais nada depois disso.
Ou talvez, pensou, ele devesse fazer alguma coisa. Fez a coisa mais simples, que era apertar a tecla RETURN.
Arby viu:

SERVIÇOS ACESSÍVEIS DA REDE REMOTA
_______________________________________________________________
ARQUIVOS ATUAIS ÚLTIMA MODIFICAÇÃO
P/Pesquisa 02/10/89
Pr./Produçao 05/10/89
C/Reg. de campo 09/10/89
M/Manutenção 12/11/89
A/Administração 11/11/89
ARQUIVOS DE DADOS ARMAZENADOS
Pl/Pesquisa (AV-AD) 01/11/89
P2/Pesquisa (GD-99) 12/11/89
Pr./Produção (FD-FN) 09/11/89

REDE DE VÍDEO
A, 1-20 CCD NDC.1.1

Então existia um antigo sistema. Os arquivos há anos não eram modificados. Para ver se ainda funcionava, ele clicou a REDE DE VÍDEO e surpreso viu a tela
começar a se encher de pequenas imagens de vídeo. Eram quinze ao todo, enchendo toda a tela, mostrando imagens de várias partes da ilha. A maioria das câmeras parecia
estar no alto, em árvores ou coisas assim, e mostravam...
Arby arregalou os olhos.
Mostravam dinossauros.
Olhou mais de perto. Não era possível. Estava vendo um filme ou alguma coisa parecida. Num dos cantos ele viu um bando de tricerátops. No outro quadrado,
umas coisas que pareciam lagartos verdes, na relva alta, só com as cabeças aparecendo. Em outro, um único estegossauro, andando tranqüilamente.
Devem ser filmes, pensou ele. O canal dos dinossauros.
Mas então, em outra imagem, Arby viu os dois trailers na clareira. Via os escuros painéis fotovoltaicos brilhando na capota. Quase imaginou que podia ver
a si mesmo, através da janela do trailer.
Oh, meu Deus, pensou Arby.
E em outra imagem ele viu Thorne, Malcolm e Eddie entrando rapidamente no Explorer verde e seguindo para a parte de trás do laboratório. E compreendeu, chocado:
As imagens eram todas reais.

A ENERGIA ELÉTRICA


Entraram no Explorer e foram para os fundos do prédio, na direção da estação de força. No caminho, passaram por uma pequena vila à direita. Thorne viu cinco
casas pequenas do tipo rural e um prédio grande onde estava escrito "Residência do administrador". Via-se que as casas deviam ter tido belos jardins e gramados,
agora retomados pela selva. No centro do complexo, viram uma quadra de tênis, uma piscina vazia, uma pequena bomba de gasolina na frente do que parecia uma loja.
Thorne disse:
- Gostaria de saber quantas pessoas moravam aqui.
- Como sabe que todos foram embora? - perguntou Eddie.
- O que quer dizer?
- Thorne... - eles têm eletricidade. Depois de todos esses anos. Tem de haver uma explicação para isso. - Eddie, na direção, evitou as áreas de carga e descarga
e foi direto para a estação de força.
A estação de força era um bloco de concreto, sem janelas, apenas com uma faixa de aço ondulado para ventilação na parte superior. As entradas de ar de aço
estavam enferrujadas, marrom-escuras, com pontos amarelos.
Eddie deu a volta no bloco, procurando uma porta. Encontrou na parte de trás. Era pesada, de aço, com um aviso com a tinta descascada que dizia: CUIDADO.
ALTA VOLTAGEM. NÃO ENTRE.
Os três saltaram do carro. Thorne farejou o ar.
- Enxofre - disse ele. Eddie tentou abrir a porta.
- Cara, tenho a sensação...
A porta abriu de repente batendo na parede de concreto com um som metálico. Eddie espiou para o escuro lá dentro. Thorne viu um labirinto de tubos, um fiozinho
de vapor erguendo-se do solo. Estava muito quente dentro da sala e havia um zumbido alto e constante.
- Caramba - disse Eddie, seguindo em frente, olhando para os medidores, muitos dos quais ilegíveis por causa da sujeira amarela no vidro. As juntas dos cabos
tinham também uma crosta amarela. Eddie limpou uma delas com o dedo. - Espantoso - ele disse.
- Enxofre?
- Sim, enxofre. Espantoso. - Virou na direção do som e viu uma entrada de ar grande e circular com uma turbina dentro. As lâminas da turbina, de um amarelo
fosco, rodavam rapidamente.
- E isso também é enxofre? - perguntou Thorne.
- Não. Deve ser ouro - respondeu Eddie. - Essas lâminas da turbina são de liga de ouro.
- Ouro?
- Isso mesmo. Teria de ser muito inerte. - Voltou-se para Thorne. - Está compreendendo o que é isto? É incrível. Tão compacto e eficiente. Ninguém ainda
descobriu como fazer isto. A tecnologia é...
- Está dizendo que é geotérmica? - perguntou Malcolm.
- Exatamente. Eles canalizaram a fonte de calor, provavelmente gás ou vapor, para passar através do solo. Então o calor é usado para ferver água num ciclo
fechado - aqueles canos lá adiante - fazendo girar a turbina - aqui - que fornece a energia elétrica. Seja qual for a fonte de calor, o processo geotérmico quase
sempre é corrosivo como o diabo. Na maioria dos lugares a manutenção é brutal. Mas esta usina ainda funciona. Espantoso.
Na parede ficava o painel principal, que distribuía a força para todo o complexo do laboratório. O painel estava manchado de mofo e amassado em vários pontos.
- Parece que ninguém vem aqui há anos - disse Eddie. - E uma grande parte da rede elétrica está inutilizada, mas a usina continua a funcionar. Incrível.
Thorne tossiu por causa do enxofre no ar e voltou para a luz do sol. Olhou para o fundo do laboratório. Uma das áreas de carga e descarga parecia em bom estado,
mas a outra estava em ruínas. O vidro nos fundos do prédio estava quebrado.
Malcolm saiu também e ficou ao lado dele.
- Será que um animal se chocou com o prédio?
- Acha que um animal podia fazer todo aquele estrago? Malcolm balançou a cabeça afirmativamente.
- Alguns desses dinossauros pesam quarenta ou cinqüenta toneladas. Um único animal tem a massa de uma manada de elefantes. Sim, pode ter sido feito por um
animal. Está vendo aquela trilha? É uma trilha de animal de grande porte que vai além da área de carga, até o sopé da colina. Sim, pode ter sido feito por animais.
- Será que não pensaram nisso quando soltaram os animais? - disse Thorne.
- Oh, tenho certeza de que planejaram soltá-los só por algumas semanas ou talvez meses. Depois recolher todos quando estivessem mais crescidos. Duvido que
tenham pensado que...
Foram interrompidos por um zumbido elétrico, como estática, que vinha de dentro do Explorer. Atrás deles, Eddie correu para o carro, preocupado.
- Eu sabia - ele disse. - Nosso módulo de comunicação está fritando. Eu sabia que devia ter sido instalado no outro. - Abriu a porta do Explorer, entrou no
lado do passageiro, apanhou o fone de ouvido e ligou o receptor automático. Pelo pára-brisa ele via Malcolm e Thorne voltando para o carro.
Então, a transmissão foi feita.
- ... no carro! - disse uma voz rouca.
- Quem é?
- Dr. Thorne! Dr. Malcolm! Entrem no carro! Quando Thorne chegou, Eddie disse:
- E aquele maldito garoto.
- O quê? - exclamou Thorne.
- É Arby.
No rádio, Arby dizia:
- Entrem no carro! Ele está chegando, eu posso ver!

- De que ele está falando? - perguntou Thorne, sem entender. - Ele não está aqui, está? Na ilha?
O rádio estalou.
- Sim, estou aqui! Dr. Thorne!
- Mas como diabo ele...
- Dr. Thorne! Entre no carro!
Thorne ficou rubro de raiva e fechou os punhos.
- Como foi que aquele filho da mãe conseguiu fazer isso? - Apanhou o fone de Eddie. - Arby, que diabo...
- Ele está chegando! Eddie disse:
- Do que ele está falando? Parece completamente histérico.
- Estou vendo na televisão! Dr. Thorne! Malcolm olhou para a selva que os rodeava.
- Talvez seja melhor entrarmos no carro - ele disse, em voz baixa.
- O que ele quer dizer com televisão? - perguntou Thorne, furioso ainda.
- Eu não sei, mas se ele conseguiu pegar alguma coisa no trailer, nós também podemos. - Eddie ligou o monitor no painel. A tela verde acendeu.
- Aquele maldito garoto - disse Thorne. - Vou torcer o pescoço dele.
- Pensei que você gostasse daquele menino - disse Malcolm.
- Eu gosto, mas...
- Caos em pleno funcionamento - disse Malcolm, balançando a cabeça.
Eddie estava olhando para o monitor.
- Oh, merda - ele disse.
No pequeno monitor do painel, eles estavam vendo o corpo enorme de um tiranossauro rex, seguindo pela trilha, na direção deles. A pele era vermelha e marrom,
a cor de sangue seco. A luz do sol filtrada entre as árvores viam os músculos potentes das ancas do animal. O dinossauro movia-se com rapidez, sem o menor sinal
de medo ou hesitação.
Com os olhos pregados na tela, Thorne disse:
- Todo o mundo para dentro do carro.
Entraram apressadamente. No monitor, o tiranossauro saiu do alcance da câmera. Mas, sentados no Explorer, eles ouviam seus passos. A terra tremia, balançando
de leve o carro.
- Ian? - disse Thorne. - O que acha que devemos fazer? Malcolm não respondeu. Estava petrificado, olhando para a frente, o rosto inexpressivo.
- Ian? - disse Thorne.
O rádio estalou e Arby disse:
- Dr. Thorne, eu o perdi no monitor. Pode vê-lo ainda?
- Jesus - disse Eddie.
Com uma velocidade espantosa o tiranossauro rex apareceu, emergindo da folhagem à direita do Explorer. O animal era imenso, do tamanho de um prédio de dois
andares, a cabeça fora do alcance dos olhos deles. Porém, para uma criatura tão grande, movia-se com incrível rapidez e agilidade. Thorne olhou atônito e em silêncio,
esperando para ver o que ia acontecer. Sentiu o carro vibrar a cada passo do animal. Eddie gemeu baixinho.
Mas o tiranossauro os ignorou. Sempre com seu passo rápido, passou pela frente do Explorer. Eles mal tiveram tempo de vê-lo antes que a cabeça e o corpo gigantesco
desaparecessem na folhagem à direita. Agora viam apenas a cauda grossa fazendo o contrapeso, a uns dois metros do solo, balançando a cada passo.
Tão rápido, pensou Thorne. Rápido! O animal gigantesco tinha aparecido, bloqueado sua visão e desapareceu. Não estava acostumado a ver uma coisa tão grande
movendo-se com tamanha rapidez. Agora via apenas a cauda balançando, acompanhando o passo rápido do animal.
Então a cauda bateu na frente do Explorer com um ruído alto de metal.
E o tiranossauro parou.
Ouviram um rosnado surdo e hesitante na selva. A cauda balançou de um lado para o outro outra vez, não com tanta decisão, e logo bateu outra vez no radiador.
A folhagem à esquerda balançou e se curvou e a cauda desapareceu.
Isso porque, Thorne compreendeu, o tiranossauro ia voltar.
O animal apareceu outra vez do meio da folhagem e caminhou para o carro até parar bem na frente deles. Rosnou outra vez, um som profundo e trovejante, e virou
a cabeça de um lado para o outro para examinar o objeto estranho. Então abaixou a cabeça e Thorne viu que o animal tinha alguma coisa na boca. As pernas da presa
balançavam nos dois lados da mandíbula do animal. Um enxame de moscas zumbia em volta da cabeça dele.
Eddie gemeu.
- Puta merda!
- Quieto - murmurou Thorne.
O tiranossauro bufou e olhou para o carro. Inclinou a cabeça outra vez e farejou repetidamente, movendo a cabeça de um lado para o outro a cada inalação.
Thorne o viu farejar o radiador e depois os pneus. Depois, levantou a cabeça enorme lentamente até ficar com os olhos acima da superfície do capo e olhou para eles
através do pára-brisa. Piscou os olhos. Era um olhar frio, como o de um réptil.
Thorne teve a impressão exata de que o tiranossauro estava olhando para eles, passando de um para o outro. Empurrou o lado do carro com o focinho redondo,
balançando-o, como para calcular o peso, medindo o oponente. Thorne segurou a direção de leve e prendeu a respiração.
Então, bruscamente, o tiranossauro recuou e foi outra vez para a frente do carro. Ficou de costas para eles, levantou a cauda e andou para trás. Ouviram quando
a cauda arranhou a capota do carro. As ancas do animal se aproximaram...
Então, o tiranossauro sentou no capo, inclinando o veículo para a frente, encostando o pára-choque no chão com seu peso enorme. Ficou imóvel por um momento,
simplesmente sentado. Depois, começou a balançar o traseiro para trás e para a frente num movimento rápido. O metal estalava.
- Que diabo ele está fazendo? - disse Eddie.
O tiranossauro levantou, o carro voltou à posição normal com um tranco, e Thorne viu a pasta branca no capo. O tiranossauro imediatamente se afastou, seguindo
a trilha, e desapareceu na selva.
Atrás deles, viram o animal aparecer outra vez e caminhar para a pequena vila. Passou atrás da loja de conveniência, depois entre duas casas e desapareceu
outra vez.
Thorne olhou para Eddie, que olhou rapidamente para Malcolm. Malcolm não tinha virado para ver a partida do tiranossauro. Estava olhando para a frente, com
o corpo tenso.
- Ian? - disse Thorne, tocando no ombro dele. Malcolm perguntou:
- Ele já foi?
- Sim. Ele já foi.
Ian Malcolm relaxou o corpo, curvando os ombros para a frente. Ele soltou o ar dos pulmões lentamente e encostou o queixo no peito. Respirou fundo e levantou
a cabeça.
- Vocês têm de admitir que não se vê uma coisa dessas todos os dias.
- Você está bem? - perguntou Thorne.
- Sim, claro, eu estou ótimo. - Levou a mão ao peito, sentindo o coração. - É claro que estou bem. Afinal, aquele era apenas um dos pequenos.
- Pequeno? - exclamou Eddie. - Chama aquela coisa de pequena?
- Sim, para um tiranossauro. As fêmeas são bem maiores. Há um dimorfismo sexual nos tiranossauros, as fêmeas são maiores do que os machos. E geralmente são
elas que se encarregam da caça. Mas é possível que cheguemos a descobrir isso pessoalmente.
- Espere um pouco - disse Eddie. - Por que tem certeza de que era um macho?
Malcolm apontou para o capo do carro, para a pasta que exalava agora um cheiro forte.
- Ele marcou seu território.
- E daí? Talvez as fêmeas também possam marcar...
- E possível que possam - disse Malcolm. - Mas o cheiro das glândulas anais só existe nos machos. E você viu como foi que ele fez isso.
Eddie olhou tristemente para o capo.
- Espero que a gente possa tirar essa coisa daí. Eu trouxe alguns solventes, mas não estava esperando, vocês sabem... cocô de dinossauro.
O rádio estalou.
- Dr. Thorne - disse Arby. - Dr. Thorne? Está tudo bem?
- Sim, Arby. Graças a você.
- Então, o que estão esperando? Dr. Thorne? Já viram o doutor Levine?
- Não, ainda não. - Thorne apanhou seu sensor que tinha caído no chão. As coordenadas de Levine tinham mudado. - Ele está se movendo...
- Eu sei que ele está se movendo. Dr. Thorne?
- Sim, Arby - disse Thorne. - Espere um pouco. Como você sabe que ele está se movendo?
- Porque eu posso vê-lo - disse Arby. - Ele está numa bicicleta.

Kelly apareceu na frente do trailer, bocejando e afastando o cabelo do rosto.
- Com quem você está falando, Arby? - Olhou para o monitor. - Ei, legal.
- Eu entrei na rede do Sítio B - ele disse.
- Que rede?
- É um rádio LAN, Kel. Não sei por quê mas ainda está funcionando.
- É mesmo? Mas como foi que você...
- Meninos - Thorne disse, no rádio. - Se não se importam. Estamos procurando Levine.
Arby apanhou o fone.
- Ele está andando de bicicleta numa trilha na selva. E bastante íngreme e estreita. Acho que está seguindo o mesmo caminho do tiranossauro.
Kelly disse:
- O mesmo caminho de quê?

Thorne ligou o motor, engatou a marcha e afastaram-se da estação de força, seguindo para o complexo habitacional dos trabalhadores. Passou pelo posto de gasolina
e depois entre as casas. O mesmo caminho do tiranossauro. A trilha era bastante larga, fácil de seguir.
- Esses garotos não deviam estar aqui - Malcolm disse, sombriamente. - Não é seguro.
- Não podemos fazer muita coisa agora - respondeu Thorne, ligando o rádio. - Arby, está vendo Levine?
O carro deu um pulo quando passou por cima do que devia ter sido um canteiro e passaram por trás da residência do administrador. Era um prédio grande de dois
andares em estilo colonial tropical, com varandas de madeira de lei em volta do segundo andar. Como as outras casas, estava cheia de mato.
O rádio estalou.
- Sim, Dr. Thorne. Estou vendo.
- Onde ele está?
- Está seguindo o tiranossauro. De bicicleta.
- Seguindo o tiranossauro. - Malcolm suspirou. - Eu nunca devia ter me envolvido com ele.
- Nós todos concordamos com isso - disse Thorne. Acelerou, passando por uma parede de pedra, desmoronada, que parecia marcar o perímetro do complexo. O carro
entrou na selva, seguindo a trilha.
No rádio, Arby disse:
- Já está vendo o Dr. Levine?
- Ainda não.
A trilha ficava cada vez mais estreita, cheia de curvas, descendo a colina. Fizeram uma curva e de repente viram uma árvore caída bloqueando a passagem. A
árvore estava nua no centro, com os galhos sem folhas e partidos - provavelmente pisada repetidamente pelos grandes animais.
Thorne parou na frente da árvore. Desceu e foi para a parte de trás do Explorer.
- Thorne - disse Eddie. - Deixe que eu faço isso.
- Não. Se acontecer alguma coisa, você é o único que pode consertar o equipamento. Você é mais importante. Especialmente agora que temos de pensar nos garotos.
Thorne soltou a moto dos ganchos que a prendiam no reboque. Verificou a carga da bateria e a levou para a frente do carro. Disse para Malcolm:
- Dê-me o rifle - e dependurou a arma no ombro. Apanhou os fones do painel e os encaixou na cabeça. Pôs a bateria no cinto e o microfone perto da boca. -
Vocês dois, voltem para o trailer. Tomem conta dos garotos.
- Mas... - Eddie começou a dizer.
- Façam o que estou dizendo. - Passou a moto por cima da árvore caída e montou. Então viu que suas mãos estavam sujas da secreção branca de cheiro forte espalhada
no tronco. Olhou para Malcolm interroga ti vãmente.
- Marcando território - disse Malcolm.
- Isso é grande - disse Thorne. -Grande! -Limpou as mãos na calça.
Depois ligou a moto e foi embora.

A folhagem batia nos ombros e nas pernas de Thorne montado na moto, seguindo a trilha do tiranossauro. O animal estava alguma distância à frente, mas ele
não o via. Thorne seguia rapidamente. O rádio estalou e Arby disse:
- Doutor Thorne? Estou vendo o senhor agora.
- Muito bem - disse Thorne.
- Mas não vejo o Dr. Levine. - Arby parecia preocupado. A moto elétrica quase não fazia barulho, especialmente na
descida. Mais adiante, a trilha dividia-se em duas. Thorne parou e se inclinou para o lado, examinando o solo lamacento. Viu as pegadas do tiranossauro à
esquerda. E viu também a linha fina dos pneus da bicicleta. Também indo para a esquerda.
Tomou a trilha da esquerda, agora mais devagar.
Dez metros adiante, Thorne passou pela perna semidevorada de uma criatura, no lado da estrada. Parecia de um animal morto há muito tempo, cheia de vermes
e moscas. No calor da manhã, o cheiro dava náuseas. Ele continuou e logo viu o crânio de um animal grande, ainda com um pouco de carne verde, também coberta de moscas.
Ele disse no microfone:
- Estou passando por um pedaço de carcaça... Um pouco de estática e Malcolm disse:
- Era isso o que eu temia.
- Temia por quê?
- Deve haver um ninho - disse Malcolm. - Você viu a carcaça que o tiranossauro tinha na boca? Estava podre mas ele não a comeu. Ebem provável que estivesse
levando comida para casa, para o ninho.
- Um ninho de tiranossauro... - disse Thorne.
- Eu teria muito cuidado - avisou Malcolm.
Thorne pôs a moto em ponto morto e desceu assim o resto da encosta. Quando chegou ao plano, desceu da moto. Sentia a terra vibrar sob os pés e nos arbustos
à sua frente ouviu um rosnado profundo, como o ronronar de um enorme gato selvagem. Olhou em volta. Não viu nem sinal da bicicleta de Levine.
Thorne tirou o rifle do ombro e o segurou com as mãos úmidas de suor. Ouviu o rosnado outra vez, aumentando e diminuindo. Então, percebeu alguma coisa estranha
no som e depois de um curto momento compreendeu o que era.
Vinha de mais de uma fonte, mais de um animal grande estava rosnando entre os arbustos bem à sua frente.
Thorne apanhou um punhado de relva e jogou para o ar. A relva voltou e bateu nas suas pernas. Ele estava contra o vento. Entrou silenciosamente no meio da
folhagem.
As samambaias eram enormes e densas, mas adiante ele via o sol numa clareira. O rosnado estava muito alto agora. Havia outro som também - estranho, como um
rangido. Era alto e a princípio, parecia quase mecânico, como uma roda com falta de óleo.
Thorne hesitou. Então, muito lentamente, abaixou as folhas. E olhou, atônito.

O NINHO


À luz da manhã, dois tiranossauros enormes - seis metros de altura - surgiram ameaçadores na sua frente. A pele avermelhada parecia couro. As cabeças enormes
ferozes, com mandíbulas imensas e dentes longos e aguçados. Mas por algum motivo Thorne não teve a sensação de estar ameaçado. Os animais moviam as cabeças lentamente,
quase com delicadeza, por cima de uma barreira circular de lama de quase um metro e meio de altura. Com pedaços de carne vermelha na boca os dois adultos abaixaram
a cabeça, atrás da parede de lama. O movimento foi recebido por um som alto e estridente que parou quase imediatamente. Então, os adultos ergueram as cabeças outra
vez. Acarne tinha desaparecido.
Não havia dúvida. Ali estava o ninho. E Malcolm estava certo. Um tiranossauro era bem maior do que o outro.
Os guinchos estridentes recomeçaram. Pareciam de filhote de aves. Os adultos continuaram a abaixar e levantar a cabeça, alimentando os filhotes invisíveis.
Havia um pedaço de carne no topo da muralha de terra. Thorne viu um filhote aparecer por cima da parede e começar a se arrastar para o lado. O filhote tinha o tamanho
de um peru, com a cabeça e os olhos muito grandes. A penugem vermelha que cobria seu corpo fazia-o parecer frágil. Tinha um anel de penugem branca em volta do pescoço.
O filhote guinchava repetidamente enquanto se arrastava desajeitado na direção da carne, usando os braços fracos. Mas, quando finalmente alcançou a carniça, avançou
para a frente, mordendo a carne com os dentes pequenos e cortantes.
Estava ocupado com o pedaço de carniça quando, de repente, deu um grito de susto e deslizou para fora do muro de terra. Imediatamente a mãe tiranossauro abaixou
a cabeça e interceptou a queda do filhote, empurrando-o gentilmente de volta para o ninho. Thorne ficou impressionado com a delicadeza de movimentos, com o cuidado
atencioso que ela dedicava ao filhote. O pai continuava a cortar pequenos pedaços de carne. Os dois animais ronronavam o tempo todo, como para tranqüilizar os filhotes.
Thorne mudou de posição. Pisou num galho seco, que estalou com um ruído alto.
Os dois adultos ergueram as cabeças imediatamente.
Thorne ficou imóvel e prendeu a respiração.
Os tiranossauros examinaram toda a área em volta do ninho, olhando atentamente em todas as direções. Seus corpos estavam tensos, as cabeças, alerta. Os olhos
giravam de um lado para o outro, com pequenos movimentos bruscos da cabeça. Depois de um momento a tensão desapareceu. Balançaram a cabeça para cima e para baixo
e esfregaram os focinhos um no outro. Parecia um movimento ritual, quase uma dança. Só então recomeçaram a alimentar os filhotes.
Quando viu que eles estavam calmos, Thorne afastou-se silenciosamente na direção da moto. Arby murmurou no rádio.
- Dr. Thorne, não estou vendo o senhor.
Thorne não respondeu. Bateu com o dedo no microfone para indicar que tinha ouvido. Arby murmurou:
- Acho que sei onde está o Dr. Levine. Está à sua esquerda. Thorne bateu outra vez no microfone, virou para a esquerda e
viu uma bicicleta enferrujada na qual estava escrito "Prop. InGen Corporation". Estava encostada numa árvore.
Nada mau, pensou Arby, olhando os vídeos remotos e clicando comandos. O monitor estava agora dividido em quatro partes. Permitia uma boa variedade de ângulos
com imagens de bom tamanho.
Numa delas ele via, de cima, os dois tiranossauros na clareira isolada. Metade da manhã já havia passado e o sol brilhava na relva amassada e cheia de lama
da clareira. No centro, ele via o ninho dentro da muralha redonda de terra. Dentro havia quatro ovos brancos, do tamanho de uma bola de futebol americano. Havia
também fragmentos de ovos e dois filhotes de tiranossauros que pareciam exatamente filhotes de passarinho, piando e sem penas. Estavam no ninho com as cabeças voltadas
para cima, as bocas abertas, esperando o alimento. Kelly olhou para a tela e disse:
- Veja como são engraçadinhos. - E acrescentou. - Nós devíamos estar lá.
Arby não respondeu. Não tinha muita certeza de querer estar mais perto dos animais. Os adultos estavam agindo com muita calma, mas para ele, a idéia de dinossauros
era por demais perturbadora. Arby sempre encontrava segurança organizando e tendo sempre em ordem sua vida - até mesmo dispor as imagens corretamente na tela do
computador era um calmante para ele. Mas tudo naquela ilha era desconhecido e imprevisível. Nunca sabia o que ia acontecer. Para Arby isso era muito perturbador.
Quanto a Kelly, estava entusiasmada. Não parava da falar dos tiranossauros, do tamanho deles, do tamanho dos dentes. Parecia não sentir medo algum.
Arby já estava irritado com ela.
- Afinal - disse Kelly -, por que você pensa que sabe onde está o Dr. Levine?
Arby apontou para a imagem do ninho, no monitor.
- VeJa.
- Estou vendo.
- Não. Fique olhando com atenção, Kel.
A imagem se moveu um pouco, abrindo-se para a esquerda, depois centralizou outra vez.
- Está vendo isso? - perguntou Arby.
- E daí? Talvez o vento esteja balançando a câmera, ou coisa parecida.
Arby balançou a cabeça.
- Não, Kel. Ele está em cima da árvore. Levine está movendo a câmera.
- Oh! - Uma pausa. Ela olhou outra vez. - Talvez tenha razão.
Arby pensou, com um largo sorriso, que não podia esperar mais de Kelly.
- Sim, acho que tenho - ele disse.
- Mas o que o Dr. Levine está fazendo lá?
- Talvez ajustando a câmera. Ouviram a respiração de Thorne no rádio.
Kelly olhou para as quatro imagens de vídeo, cada uma mostrando uma vista diferente da ilha e suspirou.
- Mal posso esperar para ir até lá.
- É, eu também - disse Arby. Mas não era verdade. Olhou '] pela janela e viu o Explorer voltando com Eddie e Malcolm. Não disse nada, mas ficou contente
com a volta deles.

Thorne parou debaixo da árvore e olhou para cima. Não podia ver Levine, mas sabia que ele estava lá porque, na opinião de Thorne, ele estava fazendo um bocado
de barulho. Thorne olhou nervosamente para a clareira atrás da folhagem densa. Ouvia ainda o ronronar dos filhotes, regular, ininterrupto.
Thorne esperou. Que diabo Levine estava fazendo lá em cima, na árvore? Ouviu o farfalhar dos galhos e depois silêncio. Um resmungo. Os galhos farfalharam
outra vez.
E então Levine disse em voz alta.
- Oh, droga!
O ruído de galhos se partindo e um grito de dor. Então Levine despencou bem na frente de Thorne, aterrissando de costas no chão. Rolou para o lado, segurando
o ombro.
- Diabo! - ele disse.
Levine estava com a roupa caqui cheia de lama e rasgada cm vários lugares. Sob a barba de três dias, o rosto estava abatido " cheio de lama. Olhou para Thorne
com um largo sorriso.
- Ei, você é a última pessoa que eu esperava ver aqui. Mas chegou na hora exata.
Thorne estendeu a mão, e Levine levantou o braço para segurá-la, quando, atrás deles, o tiranossauro rugiu ensurdecedoramente.
- Oh, não! - exclamou Kelly.
No monitor, os tiranossauros estavam agitados, movendo-se rapidamente em círculos, levantando as cabeças e urrando.
- Dr. Thorne? O que está acontecendo? - perguntou Arby. Ouviram a voz de Levine, fraca e áspera no rádio, mas não compreendiam o que ele dizia. Eddie e Malcolm
entraram no trailer. Malcolm olhou para o monitor e disse.
- Diga a eles para saírem de lá agoral
No monitor, os dois tiranossauros estavam de costas um para o outro, cada um olhando para um lado, em posição de defesa. Os filhotes estavam protegidos, no
centro. Os adultos passavam as caudas de um lado para o outro no ninho, acima das cabeças dos filhotes. A tensão era palpável.
Então um dos adultos urrou e avançou para fora da clareira.
- Dr. Thorne! Dr. Levine! Saiam daí!

Thorne montou na moto e segurou com força no guidom. Levine subiu na garupa, segurando na cintura dele. Thorne ouviu um rugido medonho e, ao olhar para trás,
viu um dos tiranossauros explodir do meio da folhagem e avançar para eles. O animal estava correndo a toda a velocidade - cabeça abaixada, mandíbulas abertas, em
posição de ataque.
Thorne deu a partida, o motor elétrico zumbiu, a roda de trás girou na lama, sem se mover.
- Vá! - gritou Levine. - Vá!
O tiranossauro avançou para eles. Thorne sentiu o chão tremer. O rugido era tão alto que seus ouvidos doíam. O tiranossauro estava quase em cima deles, a
cabeça enorme estirada para a frente, a boca aberta...
Thorne firmou os calcanhares no chão, impelindo a moto para a frente. De repente, a roda traseira se soltou, jogando lama por todo o lado e a moto roncou
velozmente na trilha. Thorne acelerou. A moto balançava e derrapava perigosamente na lama.
Atrás dele, Levine gritava alguma coisa que Thorne não ouvia. Seu coração batia loucamente. A moto saltou numa vala e os dois quase perderam o equilíbrio,
depois Thorne acelerou outra vez. Thorne não ousava olhar para trás. Sentia o cheiro de carne podre, ouvia a respiração áspera do animal gigantesco...
- Vá com calma! - gritou Levine.
Thorne o ignorou. A moto roncou subindo a colina. A folhagem batia neles, a lama saltava no rosto e no peito. Mais uma vez a moto saltou num buraco, deslizou
para o lado, e ele a levou de volta para o meio da trilha. Ouviu outro rugido e teve a impressão de que estava mais fraco, mas...
- Thorne! - gritou Levine, com a boca perto do ouvido dele.
- O que está fazendo? Quer nos matar? Estamos sozinhos!
Thorne chegou a um trecho plano da trilha e arriscou uma olhada para trás. Levine tinha razão. Estavam sozinhos. Não viu nem sinal do tiranossauro, mas ouvia
ainda o rugido, agora distante.
Ele diminuiu a marcha.
- Calma - disse Levine, balançando a cabeça. Estava pálido de medo. - Você dirige pessimamente, sabia? Devia aprender. Quase nos matou.
- Ele estava nos atacando - Thorne disse, zangado. Estava acostumado com o espírito crítico de Levine, mas naquele momento...
- Absurdo - disse Levine. - Ele não estava atacando ninguém.
- Pois pode estar certo que parecia.
- Não, não, não - disse Levine. - Ele não estava nos atacando. O rex estava defendendo o ninho. Há uma grande diferença.
- Não vi diferença nenhuma - insistiu Thorne. Parou a moto e olhou para Levine.
- Para falar a verdade - explicou Levine -, se o rex tivesse resolvido nos atacar, estaríamos mortos agora. Mas ele parou quase imediatamente.
- Parou? - perguntou Thorne.
- Certeza absoluta - respondeu Levine, com seu modo pedante. - O rex só queria nos assustar e defender seu território. Ele nunca deixaria o ninho indefeso,
a não ser que tivéssemos tirado ou avariado alguma coisa. Tenho certeza de que neste momento ele está lá com a companheira, cuidando dos ovos, e não pretende ir
a lugar nenhum.
- Então, acho que é uma sorte ele ser um pai tão dedicado - disse Thorne, ligando o motor.
- E claro que é um pai dedicado - continuou Levine. - Qualquer tolo pode ver. Não notou como ele está magro? Está se alimentando mal para não faltar comida
para os filhotes. Provavelmente faz isso há semanas. O tiranossauro rex é um animal complexo, com comportamento de caça complexo. E um comportamento complexo também
no modo como cuida dos filhos. Eu não ficaria surpreso se verificasse que o papel de pai e mãe do tiranossauro rex dura alguns meses. Ele pode ensinar os filhotes
a caçar, por exemplo. Começa trazendo pequenos animais feridos e deixa que os filhotes acabem com eles. Esse tipo de coisa. Seria interessante descobrir exatamente
o que ele faz. Por que estamos parados aqui?
Malcolm disse no rádio:
- Jamais ocorreria a ele agradecer a você por salvar sua vida. Thorne rosnou:
- E evidente que não.
- Com quem está falando? - perguntou Levine. - Com Malcolm? Ele está aqui?
- Está - disse Thorne.
- Ele está concordando comigo, não está?
- Não exatamente - disse Thorne, balançando a cabeça.
- Escute, Thorne - disse Levine. - Sinto muito se ficou aborrecido. Mas não tem motivo nenhum. A verdade é que nem por um momento corremos perigo, exceto
com seu modo de dirigir a moto.
- Ótimo. Isso é ótimo. - O coração de Thorne saltava como louco no peito. Ele respirou fundo, virou a moto para a esquerda e seguiu a trilha, de volta para
os trailers.
Atrás dele, Levine disse:
- Estou muito feliz por vê-lo, Thorne. De verdade.
Thorne não respondeu. Continuou a descer na trilha, entre a folhagem. Chegando ao vale, ele acelerou. Logo viram os trailers na clareira, lá embaixo. Levine
disse:
- Ótimo. Você trouxe tudo. O equipamento está funcionando? Tudo em boas condições?
- Tudo parece ótimo.
- Perfeito - disse Levine. - Então isto é simplesmente perfeito.
- Talvez não - disse Thorne.
Dentro no trailer, Arby e Kelly acenavam alegremente atrás do vidro da janela.
- Está brincando - disse Levine.

QUARTA CONFIGURAÇÃO

Aproximando-se do limite caótico, os elementos
demonstram conflito interno. Uma região instável e
potencialmente letal.


IAN MALCOLM

LEVINE


Eles atravessaram a clareira correndo e gritando:
- Dr. Levine! Dr. Levine! Está salvo! - Abraçaram.Leyjne e ele olhou para Thorne.
- Isto foi muito insensato - disse Levine.
- Por que não explica isso a eles? - perguntou Thorne. - Eles são seus alunos.
- Não fique zangado, Dr. Levine - Kelly pediu. - Nós viemos por nossa conta.
- Por sua conta?
- Pensamos que o senhor precisasse de ajuda - disse Arby.
- E precisava. - Olhou para Thorne.
- Sim. Eles nos ajudaram - confirmou Thorne.
- E prometemos que não vamos atrapalhar - disse Kelly. - Façam o que têm de fazer, que nós...
- Os meninos estavam preocupados com você - disse Malcolm.
- Julgaram que estivesse em apuros.
- Afinal, por que toda a pressa? - quis saber Thorne. - Mandou construir todos esses veículos e depois veio embora sem nenhum deles...
- Não tive escolha - disse Levine. - O governo está às voltas com uma epidemia de um novo tipo de encefalite. Acham que está relacionada com as ocasionais
carcaças de dinossauros que aparecem por lá, levadas pelo mar. E claro que a idéia é idiota, mas isso não impede que continuem a destruir os animais, assim que os
encontram. Tive de ir lá primeiro. O tempo é curto.
- Depois, veio para cá sozinho - disse Malcolm.
- Bobagem, Ian. Deixe de fazer essa cara. Eu ia telefonar para você, assim que tivesse verificado o que havia nesta ilha. E não vim sozinho. Vim com um guia
chamado Diego, que jurou ter estado nesta ilha alguns anos atrás, quando menino. E parecia ter bastante experiência. Levou-me ao alto do rochedo sem problema. E
tudo estava indo muito bem até sermos atacados no regato e Diego...
- Atacados? - perguntou Malcolm. - Pelo quê?
- Na verdade, eu não vi - disse Levine. - Tudo aconteceu muito depressa. O animal me derrubou, rasgou minha mochila e na verdade não sei o que aconteceu depois
disso. É possível que o formato da mochila o tenha confundido, porque eu levantei e corri e ele não me perseguiu.
Malcolm olhava atônito para ele.
- Você teve muita sorte, Richard.
- Sim. Bem, eu corri por um longo tempo. Quando olhei para trás, estava sozinho na selva. E perdido. Não sabia o que fazer e subi numa árvore. Pareceu-me
uma boa idéia e depois, mais ou menos no começo da noite, os velocirraptores apareceram.
- Velocirraptores? - perguntou Arby.
- Pequenos carnívoros - disse Levine. - O formato do corpo é basicamente de um terópodo, focinho comprido, visão binocular. Um dinossauro pequeno, muito rápido,
muito inteligente e muito perigoso; e eles andam em grupos. E ontem à noite havia oito deles, saltando em volta da árvore, tentando me pegar. Durante a noite inteira,
pulando, pulando e rosnando... Não consegui dormir um minuto.
- Ora, que pena - disse Eddie.
- Escute - Levine disse, irritado. - Não é meu problema se...
- Você passou a noite na árvore? - quis saber Malcolm.
- Passei. E de manhã os raptores tinham ido embora. Então desci e comecei a andar. Encontrei o laboratório ou seja lá o que for. E evidente que foi abandonado
às pressas, deixando alguns animais para trás. Andei pelo prédio todo e descobri que ainda há eletricidade - alguns sistemas ainda funcionam, depois de todos esses
anos. E o mais importante: há uma rede de câmeras de segurança. Uma grande sorte. Então resolvi ver como estavam as câmeras, e estava trabalhando quando vocês interromperam...

- Espere um pouco - disse Eddie. - Viemos aqui para salvá-lo.
- Não sei por quê - disse Levine. - Estou certo de que nunca pedi que fizessem isso.
- Parecia que queria - disse Thorne - no telefone.
- Aquilo foi um mal-entendido - explicou Levine. - Fiquei preocupado por um momento porque não conseguia fazer o telefone funcionar. Thorne, você fez esse
telefone muito complicado. Esse é o problema. Então, podemos começar?
Olhou para os rostos zangados a sua volta. Malcolm disse para Thorne:
- Um grande cientista e um grande ser humano.
- Ouçam - disse Levine. - Eu não sei qual é o problema de vocês. A expedição viria a esta ilha mais cedo ou mais tarde. Dadas as circunstâncias, quanto mais
cedo, melhor. Tudo saiu muito bem e, francamente, não vejo motivo para discussão. Não é a hora para briguinhas tolas. Temos coisas importantes para fazer, e acho
que devemos começar. Porque esta ilha é uma oportunidade extraordinária e não vai durar para sempre.


DODGSON


Lewis Dodgson estava de frente para o balcão do bar, num canto escuro da Chesperito Cantina, em Puerto Cortês, tomando uma cerveja. Ao lado dele, George Baselton,
o catedrático de biologia de Stanford, devorava avidamente um prato de huevos rancheros. As gemas se derramavam sobre a salsa verde. Dodgson sentia náuseas só de
olhar. Virou o rosto, mas ouvia ainda Baselton lambendo os lábios ruidosamente.
O bar estava vazio, a não ser pelas galinhas ciscando no chão. Uma vez ou outra um garoto chegava na porta, atirava pedras nas galinhas e corria para fora,
rindo satisfeito. O estéreo arranhava uma antiga canção de Elvis Presley na caixa acústica enferrujada acima do bar. Dodgson cantarolava "Falling in Love with You",
tentando conter a irritação. Estava sentado naquele monte de lixo há quase uma maldita hora.
Baselton terminou os ovos e empurrou o prato. Tirou então do bolso o pequeno bloco de anotações que tinha sempre à mão.
- Muito bem, Lewis - ele disse. - Estive pensando no melhor meio de resolver isso.
- Resolver o quê? - perguntou Dodgson, de mau humor. - Não há nada para resolver, desde que possamos chegar àquela ilha. - Enquanto falava, pôs uma pequena
foto de Richard Levine na ponta do balcão do bar. Examinou as costas da foto, virou-a de cabeça para baixo. Depois de cabeça para cima.
Suspirou e olhou para o relógio.
- Lewis - Baselton disse, impaciente -, chegar à ilha não é a parte importante. O importante é como vamos apresentar ao mundo a nossa descoberta.
Dodgson pensou por um momento e depois disse:
- Nossa descoberta. Gostei disso, George. É muito bom mesmo. Nossa descoberta.
- Bem, é a verdade, não é? - disse Baselton com um leve sorriso. - A InGen está falida, sua tecnologia perdida para a humanidade. Uma perda trágica, muito
trágica, como eu disse muitas vezes na televisão. Mas, dadas as circunstâncias, qualquer um que volte a encontrá-la faz uma descoberta. Não sei de que outro modo
se pode chamar. Como disse Henri Poincaré...
- Tudo bem - disse Dodgson. - Então, fazemos uma descoberta. E depois? Damos uma entrevista coletiva?
- Definitivamente, não. - Baselton ficou horrorizado. - Uma coletiva seria algo por demais grosseiro. Ficaríamos expostos a todo tipo de crítica. Não, não.
Uma descoberta dessa magnitude deve ser tratada com decoro. Deve ser comunicada, Lewis.
- Comunicada?
- Por meio da literatura especializada. A Nature, eu creio. Sim.
Dodgson entrecerrou os olhos.
- Você quer anunciar numa publicação acadêmica?
- Sabe de um meio melhor para torná-la legítima? - disse Baselton. - É perfeitamente apropriado apresentar nossas descobertas aos nossos pares acadêmicos.
É claro que vai provocar um debate - mas no que consistirá esse debate? Uma discussão acadêmica, professores discordando de professores, que vai ocupar as seções
de ciência dos jornais durante três dias, até ser substituída pelas últimas novidades sobre implante de mamas. E nesses três dias já estabelecemos o nosso direito
de posse.
- Você vai redigi-lo?
- Vou - disse Baselton. - E mais tarde, acho, um artigo na American Scholar, ou talvez na Natural History. Alguma coisa com interesse humano, o que significa
essa descoberta para o futuro, o que nos conta sobre o passado, toda essa...
Dodgson assentiu com um gesto. Reconhecia que Baselton estava certo, lembrou o quanto precisava dele e como foi inteligente chamá-lo para fazer parte da equipe.
Dodgson jamais pensava na reação do público. E Baselton não pensava em outra coisa.

- Bem, isso é ótimo - ele disse. - Mas nada tem importância se não chegarmos àquela ilha. - Consultou o relógio outra vez.
Uma porta se abriu atrás deles e o assistente de Dodgson, Howard King, entrou, rebocando um costa-riquenho forte e atarracado, de bigode. O homem tinha o
rosto marcado pelas intempéries e uma expressão carrancuda.
Dodgson virou o corpo na banqueta.
- Este é o homem?
- Sim, Lew.
- Qual o nome dele?
- Gandoca.
- Senor Gandoca. - Dodgson mostrou a foto de Levine. - Conhece este homem?
Gandoca mal olhou para a foto e fez que sim com a cabeça.
- Si. Senor Levine.
- Certo. Senor cretino Levine. Quando ele esteve aqui?
- Há poucos dias. Ele saiu com Dieguito, meu primo. Ainda não voltaram.
- E aonde eles foram?
- Islã Sorna.
- Ótimo - disse Dodgson, acabando de tomar a cerveja e empurrando a garrafa. - Você tem barco? - Virou para King. - Ele tem um barco?
- Ele é pescador - disse King. - Tem um barco. Gandoca fez que sim e disse:
- Um barco de pesca. Si.
- Ótimo. Eu também quero ir à Islã Sorna.
- Si, senor, mas hoje o tempo...
- Pouco me importa o tempo - disse Dodgson. - O tempo vai melhorar. Quero ir agora.
- Talvez mais tarde...
- Agora.
Gandoca levantou as mãos abertas.
- Eu sinto muito, senor...
Dodgson disse:
- Mostre o dinheiro para ele, Howard.
King abriu uma valise cheia de notas de cinco mil colóns. Gandoca olhou, apanhou uma das notas, examinou. Pôs na valise cuidadosamente, balançou o corpo.
- Eu quero ir agora - disse Dodgson.
- Si, senor - respondeu Gandoca. - Partimos quando o senor estiver pronto.
- Assim é melhor - disse Dodgson. - Quanto tempo leva para chegar à ilha?
- Umas duas horas, senor.
- Muito bem. Isso é ótimo.


O POSTO DE OBSERVAÇÃO


- Aqui vamos nós!
Ouviram um clique quando Levine ligou o cabo flexível do guincho elétrico do Explorer e apertou o botão. O cabo girou lentamente à luz do sol.
Estavam agora numa extensa planície coberta de relva na base do rochedo. O sol do meio-dia estava alto no céu, refletindo na borda rochosa da ilha. Lá embaixo,
o vale cintilava com as ondas de calor.
Uma manada de hipsilofodontes pastava a uma pequena distância. Os animais verdes, parecidos com gazelas, erguiam a cabeça ocasionalmente acima da relva e
olhavam para eles sempre que ouviam o ruído de metal, enquanto Eddie e os meninos armavam o suporte de alumínio, motivo de tanta especulação quando estavam na Califórnia.
O conjunto parecia agora um monte de longarinas estreitas - uma versão aumentada de escoras de picape - sobre a relva.
- Agora vamos ver - disse Levine, esfregando as mãos. Quando o motor foi ligado, as longarinas começaram a se
mover e lentamente ergueram-se no ar. A estrutura parecia frágil e delicada, mas Thorne sabia que os suportes cruzados garantiam uma grande resistência. Desdobrando
as longarinas, a estrutura ergueu-se a três metros de altura, depois a quatro metros e meio e finalmente parou. A pequena casa no alto estava logo abaixo dos galhos
mais baixos das árvores próximas, que quase a escondiam de vista. Mas a armação, como um andaime, brilhava ao sol.
- É isso? - perguntou Arby.
- Sim, é isso. - Thorne andou em volta, encaixando os pinos para manter a estrutura de pé.
- Mas brilha demais - disse Levine. - Devíamos ter feito escura.
- Eddie, precisamos esconder isto - disse Thorne.
- Quer usar spray? Acho que eu trouxe tinta preta. Levine balançou a cabeça.
- Não, a tinta tem cheiro forte. Que tal aquelas palmeiras?
- Certo. Podemos fazer isso. - Eddie foi até as palmeiras e começou a cortar as folhas com sua pequena machadinha.
Kelly olhou para a construção de alumínio.
- E legal - ela disse. - Mas o que é?
- Um esconderijo aéreo - disse Levine. - Venha. - Ele começou a escalar o andaime.
A estrutura no topo era uma pequena casa, o teto escorado por barras de alumínio a intervalos de um metro e vinte umas das outras. O assoalho era também de
barras de alumínio, porém mais juntas, com intervalos de mais ou menos quinze centímetros. Era escorregadio, e Levine apanhou algumas folhas de palmeira que Eddie
estava suspendendo com uma corda e cobriu o chão com elas. As outras folhas de palmeira ele prendeu no lado de fora da casa, escondendo a estrutura.
' Arby e Kelly olharam para os animais. Do alto viam todo o vale. Viram um bando mais distante de apatossauros, no outro lado do rio. Um grupo de tricerátops
pastava ao norte. Perto da água, alguns dinossauros bicos-de-pato com cristas longas aproximaram-se para beber. Um grito surdo dos bicos-de-pato flutuou pelo vale
na direção deles, um som profundo e não deste mundo. Logo depois, ouviram a resposta vinda da floresta no outro lado do vale.
- O que foi isso? - Kelly perguntou.
- Um parassauro - disse Levine. - Ele solta o grito através da crista na nuca. Sons de baixa freqüência atingem grandes distâncias.
Ao sul viram um bando de animais verde-escuros com a parte da frente da cabeça grande e saltada e uma fileira de chifres pequenos e nodosos. Pareciam búfalos.

- Como se chamam aqueles? - Kelly perguntou.
- Boa pergunta - disse Levine. - Provavelmente são Pa-chycephalosaurus wyomingensis. Mas é difícil dizer com certeza porque nunca foi encontrado um esqueleto
completo desses animais. A testa é de osso muito espesso, por isso temos encontrado vários fragmentos da parte superior do crânio. Mas esta é a primeira vez que
eu vejo o animal inteiro.
- E aquelas cabeças? Para que servem? - quis saber Arby.
- Ninguém sabe - disse Levine. - Todos supõem que sejam usadas para dar marradas, para as lutas dos machos de diversas espécies. A competição para ganhar
as fêmeas, coisas assim.
Malcolm já estava lá em cima também.
- Sim, para dar marradas - ele disse, sombriamente. - Como vocês estão vendo agora.
- Tudo bem - disse Levine - então, eles não estão dando marradas no momento. Talvez a época da procriação já tenha terminado.
- Ou talvez eles nunca façam isso - disse Malcolm, olhando para os animais verdes. - Eles me parecem muito pacíficos.
- Sim - disse Levine -, mas é claro que isso não quer dizer nada. O búfalo africano parece manso a maior parte do tempo, também, quase sempre fica um tempo
enorme imóvel. Contudo, são animais imprevisíveis e muito perigosos. Temos de supor que aquelas cabeças existem por alguma razão, mesmo que não estejamos vendo agora.
Levine voltou-se para os meninos.
- Por isso eu fiz esta estrutura. Queremos observar os animais vinte e quatro horas por dia. Até onde for possível, queremos registrar suas atividades.
- Por quê? - perguntou Arby.
- Porque - foi Malcolm quem respondeu - esta ilha apresenta uma oportunidade única de estudar o maior mistério da história do nosso planeta: a extinção.
- Vejam só - disse Malcolm -, quando a InGen fechou definitivamente suas instalações, agiram apressadamente e deixaram alguns animais vivos. Isso foi há cinco
ou seis anos. Os dinossauros crescem depressa, a maioria das espécies atinge a maturidade em quatro ou cinco anos. A esta altura, a primeira geração dos dinossauros
da InGen - concebidos em laboratório - já está adulta e começou a criar uma nova geração inteiramente selvagem. Agora existe um sistema ecológico completo nesta
ilha, com dezenas de espécies de dinossauros vivendo em pequenos grupos sociais, pela primeira vez, em sessenta e cinco milhões de anos.
- E por que isso é uma oportunidade? - perguntou Arby. Malcolm apontou para a planície.
- Bem, pense um pouco. A extinção é um tema de pesquisa muito difícil. Existem dezenas de teorias conflitantes. Galileu podia subir na Torre de Pisa e jogar
bolas para testar sua teoria. Na verdade, ele nunca fez isso, mas podia ter feito. Newton usou prismas para testar sua teoria ótica. Os astrônomos observaram eclipses
para testar a teoria da relatividade, de Einstein. Os testes são feitos em todos os ramos da ciência. Mas como conduzir testes de uma teoria da extinção? Não é possível.
- Mas aqui... - disse Arby.
- Sim - continuou Malcolm -, o que temos aqui é uma população de animais extintos artificialmente introduzidos num ambiente fechado, podendo voltar a evoluir.
Nunca houve nada parecido em toda a história. Já sabemos que esses animais foram extintos uma vez. Mas ninguém sabe por quê.
- E vocês esperam descobrir? Em alguns dias?
- Sim - disse Malcolm. - Esperamos.
- Como? Não acham que eles vão ser extintos outra vez, acham?
- Quer dizer, na frente dos nossos olhos? - Malcolm riu. - Não, não. Nada disso. Mas o caso é que pela primeira vez não estamos estudando apenas ossos. Estamos
vendo os animais e observando seu comportamento. Eu tenho uma teoria e acho que, mesmo num curto espaço de tempo, veremos sua comprovação.
- Que provas? - perguntou Kelly.
- Que teoria? - disse Arby. Malcolm sorriu.
- Aguardem - ele disse.

A RAINHA DE COPAS


Os apatossauros desceram até o rio no calor do dia. Seus pescoços curvos e graciosos refletiam-se na água quando se inclinavam para beber. As caudas finas
como chicotes balançavam preguiçosamente. Sete apatossauros mais jovens e menores que os adultos brincavam no meio do bando.
- Belíssimo, não é? - disse Levine. - O modo como tudo se encaixa. Simplesmente lindo. - Virou para o lado e gritou para Thorne: - Onde está minha armação?
- Subindo - disse Thorne.
A corda ergueu um pesado tripé com base larga e uma moldura circular na parte de cima. Sobre ela estavam cinco câmeras de vídeo com fios ligados aos painéis
solares. Levine e Malcolm começaram a armar as câmeras.
- O que acontece com o vídeo? - perguntou Arby.
- Os dados são multiplexados e nós os enviamos direto para a Califórnia. Via satélite. Será ligado tambemna rede de segurança da ilha. Assim teremos vários
pontos de observação ao mesmo tempo.
- E não precisamos estar aqui?
- Certo.
- E é isso que vocês chamam de esconderijo?
- Sim. Pelo menos é assim que cientistas como Sarah Harding chamam.
Thorne subiu também. Era muita gente para o pequeno abrigo, mas Levine aparentemente não notou. Com um binóculo, observava atentamente os dinossauros na planície.
- Exatamente como pensamos - ele disse para Malcolm. - Organização espacial. Filhotes e os mais novos no centro do bando, adultos protetores na periferia.
Os apatossauros usam a cauda como defesa.
- Pelo menos parece.
- Oh, não há dúvida quanto a isso. - Levine suspirou. - Etão bom provar que estamos certos.
Lá embaixo, Eddie desempacotou a gaiola circular de alumínio, a mesma que tinham visto na Califórnia. Tinha cerca de um metro e oitenta de altura e um metro
e vinte de diâmetro, construída com barras de titânio de dois centímetros de espessura.
- O que quer que eu faça com isto? - ele perguntou.
- Deixe aí embaixo - disse Levine. - E o lugar dela.
Eddie armou a gaiola no canto do andaime. Levine desceu.
- E isso, para que serve? - perguntou Arby. - Vai pegar um dinossauro?
- Na verdade, justamente o contrário. - Levine prendeu a gaiola ao lado do andaime. Abriu e fechou a porta para ver se estava em ordem. Verificou a fechadura,
deixando a chave com a tira de elástico pendurada. - É uma gaiola para predadores, como as gaiolas para tubarões - ele disse. - Se você estiver andando aqui embaixo
e acontecer alguma coisa, entra aqui e está a salvo.
- Se acontecer o quê? - perguntou Arby, preocupado.
- Na verdade, não acredito que aconteça alguma coisa - disse Levine, subindo outra vez. - Porque duvido que os animais dêem atenção a nós ou a esta pequena
casa, depois que estiver bem camuflada.
- Quer dizer que não vão ver a casa?
- Oh, eles vão ver, mas vão ignorar.
- Mas, se nos farejarem... Levine balançou a cabeça.
- A casa está num lugar em que o vento que prevalece na ilha está na nossa direção. E deve ter notado que essas samambaias têm um cheiro característico. -
Era um cheiro levemente picante, quase como de eucalipto.
Arby continuava preocupado.
- Mas e se eles comerem as samambaias?

- Não comem - disse Levine. - Essas samambaias são Dicranopterus cyatheoides, levemente tóxicas, e provocam uma erupção no interior da boca. Há uma teoria
de que sua toxidez se desenvolveu durante o Jurássico, como defesa contra os dinossauros vegetarianos.
- Não é uma teoria - disse Malcolm. - Apenas suposição sem fundamento.
- Mas há alguma lógica nisso - observou Levine. - A vida das plantas no Mesozóico deve ter sido extremamente ameaçada pelo aparecimento dos grandes dinossauros.
Manadas de herbívoros gigantes, cada animal consumindo centenas de quilos de matéria vegetal por dia, certamente dariam para exterminar as plantas que não tivessem
criado alguma defesa - um gosto desagradável, espinhos, cerdas ou toxidez química. Assim, talvez as cyatheoides tenham desenvolvido essa toxidez naquela época. E
bastante eficiente porque os animais de hoje também não comem essa planta, em nenhum lugar do mundo. Por isso são tão abundantes, como devem ter notado.
- As plantas têm defesas? - perguntou Kelly.
- E claro que têm. As plantas evoluem como qualquer forma de vida e criam os próprios modos de agressão, defesa e assim por diante. No século XIX, a maior
parte das teorias era sobre animais - natureza vermelha, com dentes e garras e tudo o mais. Porém hoje os cientistas estão pensando na natureza verde, com raízes
e hastes. Compreendemos que as plantas, na sua luta constante para sobreviver, desenvolveram tudo, desde uma simbiose complexa com outros animais até mecanismos
de sinalização para avisar as outras plantas, para se defender da guerra química.
Kelly perguntou, intrigada:
- Sinalização? De que tipo?
- Ah, temos vários exemplos - disse Levine. - Na África, as árvores de acácia criaram espinhos longos e afiados - com sete centímetros mais ou menos -, mas
isso só serviu para fazer com que certos animais, como as girafas e os antílopes, desenvolvessem línguas mais longas que alcançavam além dos espinhos. Só os espinhos
não adiantavam. Então, na corrida evolutiva, as árvores de acácia criaram uma nova defesa, a toxidez. Começaram a produzir grandes quantidades de tanino em suas
folhas, o que provoca uma reação metabólica letal nos animais. Literalmente os mata. Ao mesmo tempo, as acácias desenvolveram uma espécie de sistema químico de alarme.
Se o antílope começa a comer as folhas de uma árvore, essa árvore libera etileno no ar e as árvores próximas aumentam a produção do tanino nas folhas. Dentro de
cinco ou dez minutos, todas as outras árvores estão produzindo mais tanino, tornando-se assim venenosas.
- E o que acontece com o antílope? Ele morre?
- Bem, não. Não morre mais porque a corrida evolutiva continuou. Os antílopes acabaram aprendendo que só podiam comer as folhas por pouco tempo. Assim que
as árvores começavam a produzir mais tanino, tinham de parar de comer. E esses herbívoros desenvolveram novas estratégias. Por exemplo, quando uma girafa come as
folhas de uma árvore de acácia, ela evita todas as árvores que estejam a favor do vento e procura uma árvore mais distante. Assim, os animais se adaptaram a essa
defesa também.
- Na teoria da evolução isso se chama fenômeno da Rainha de Copas - disse Malcolm. - Porque, em Alice no país das maravilhas, a Rainha de Copas diz para Alice
que ela tem de correr o mais depressa possível para ficar onde está. E assim que parece ser a espiral evolutiva. Todos os organismos evoluem numa fúria louca só
para conservar o mesmo equilíbrio. Para ficar onde estão.
- E isso é comum? Mesmo entre as plantas? - perguntou Arby.
- Sim, é - disse Levine. - A seu modo, as plantas são extremamente ativas. Os carvalhos, por exemplo, produzem tanino e fenol para se defender das lagartas.
Um bosque inteiro é alertado assim que uma árvore é infestada. É um modo de proteger todo o bosque, uma espécie de cooperação entre as árvores, podemos dizer.
Arby balançou a cabeça afirmativamente e olhou lá do alto para os apatossauros, ainda na margem do rio.
- Então - ele disse - é por isso que os dinossauros não comeram todas as árvores da ilha? Porque esses grandes apatossauros devem comer muitas plantas. Têm
pescoço comprido para alcançar os galhos mais altos. Mas as árvores estão praticamente intactas.
- Muito bem - disse Levine. - Eu também notei isso.
- E por causa das defesas das plantas?
- Bem, pode ser - disse Levine. - Mas eu acho que há umâ explicação muito simples para a preservação das árvores.
- O que é?
- Basta olhar - disse Levine. - Está na frente dos seus olhos.

Arby apanhou um binóculo e observou as manadas.
- Qual é a explicação simples?
- Entre os paleontólogos - disse Levine - há um debate interminável sobre por que os apatossauros têm pescoço comprido. Esses animais que está vendo têm
seis metros de pescoço. A crença tradicional é que eles desenvolveram esse pescoço comprido para comera folhagem mais alta, que não pode ser alcançada por outros
animais.
- Então? Por que a discussão? - perguntou Arby.
- A maioria dos animais neste planeta tem pescoço curto - disse Levine - porque um pescoço comprido é, bem, é uma chateação. Provoca uma série de problemas.
Problemas estruturais: a disposição dos músculos e ligamentos para dar suporte a um pescoço longo. Problemas comportamentais: os impulsos nervosos precisam percorrer
uma longa distância do cérebro ao corpo. Problemas de deglutição: o alimento percorre uma grande distância da boca até o estômago. Problemas respiratórios: o ar
tem de ser aspirado através de um canal muito longo. Problemas cardíacos: o sangue tem de ser bombeado até a cabeça, do contrário o animal desmaia. Em termos de
evolução, tudo isso é difícil.
- Mas as girafas fazem - observou Arby.
- Sim, elas fazem. Mas os pescoços das girafas não têm nem metade desse comprimento. As girafas têm coração muito grande e uma fáscia espessa em volta do
pescoço. Na verdade, o pescoço da girafa é como uma bainha de pressão sangüínea que vai até em cima.
- Os dinossauros têm essa bainha?
- Não sabemos. Supomos que os apatossauros tenham coração enorme, talvez com cento e cinqüenta quilos ou mais. Porém, há outra solução possível para o problema
de bombear o sangue num pescoço muito longo.
- Qual é?
- Você está olhando para ela neste momento. Arby bateu palmas.
- Eles não levantam o pescoço!
- Correto - disse Levine. - Pelo menos não com freqüência nem por longo tempo. E claro que, neste momento, os animais estão bebendo, portanto os pescoços
estão abaixados, mas meu palpite é que, se os observarmos por algumas horas, vamos descobrir que não ficam muito tempo com o pescoço levantado.
- Por isso não podem comer as folhas das árvores!
- Certo.
- Mas se o pescoço comprido não é usado para comer, então para que serve? - perguntou Kelly.
Levine sorriu.
- Deve ter uma utilidade e acho que é para defesa.
- Defesa? Pescoço comprido? - Arby perguntou intrigado. - Não compreendo.
- Continue olhando - disse Levine. - Na verdade é mais do que óbvio.
Arby olhou com o binóculo e disse para Kelly:
- Detesto quando ele diz que é óbvio.
- Eu sei - ela disse suspirando.
Arby olhou para Thorne. Thorne ergueu dois dedos em V e depois dobrou um deles. O movimento fez com que o outro dedo se movesse também. Portanto, os dois
eram ligados... Se era uma pista, Arby não entendeu. Franziu a testa. Thorne disse só com o movimento dos lábios: "Ponte." Arby olhou e viu as caudas que pareciam
chicotes balançando acima dos animais mais jovens.
- Já sei! - exclamou. - Eles usam a cauda para defesa. E precisam de pescoço comprido para contrabalançar a cauda longa. É como uma ponte pênsil!
Levine olhou atentamente para ele.
- Descobriu muito depressa. Thorne ficou de costas, escondendo um sorriso.
- Mas estou certo... - disse Arby.
- Sim, está absolutamente certo. Os pescoços longos existem porque as caudas longas existem. Nos terópodos, que andam nas patas traseiras, a situação é outra.
Mas nos quadrúpedes tem de haver um contrapeso para a cauda longa, do contrário o animal cai para a frente.
- Na realidade, há uma coisa muito mais interessante nesse bando de apatossauros - acrescentou Malcolm.
- Sim? O que é? - perguntou Levine.
- Eles não são adultos verdadeiros - explicou Malcolm. - Os animais que estamos vendo são muito grandes pelos nossos padrões. Mas na verdade nenhum deles
atingiu ainda o tamanho de adulto. Acho isso muito estranho.
- Acha? Pois para mim não é nada estranho - disse Levine. - Sem dúvida, isso se dá simplesmente porque não tiveram tempo suficiente para chegar à maturidade.
Tenho certeza de que os apatossauros crescem mais devagar do que os outros dinossauros. Afinal, os grandes mamíferos, como os elefantes, crescem mais devagar do
que os mamíferos menores.
Malcolm balançou a cabeça.
- A explicação não é essa.
- Não? Então qual é?
- Continue olhando - Malcolm disse, apontando para a planície. - Na verdade é extremamente óbvio.
Os meninos riram.
Levine estremeceu, demonstrando seu desagrado.
- O que me parece óbvio - ele disse - é que nenhuma das espécies parece ter chegado ao amadurecimento completo. Os tricerátops, os apatossauros e até mesmo
os parassauros são um pouco menores que o que podíamos esperar. Isso sugere um fator consistente, algum elemento da dieta, os efeitos do confinamento numa pequena
ilha, talvez até mesmo o modo como foram criados. Mas não considero isso especialmente notável ou motivo para preocupação.
- Talvez tenha razão - disse Malcolm. - Talvez não tenha.

PUERTO CORTÊS


- Não há nenhum vôo? - perguntou Sarah Harding. - Como não há nenhum vôo?
Eram onze horas da manhã. Harding tinha voado quinze horas, grande parte desse tempo no avião militar norte-americano que tomara de Nairóbi para Dallas. Estava
exausta. Sentia a pele pegajosa, precisava de um chuveiro e queria trocar de roupa. Mas estava ali discutindo com aquele funcionário teimoso, numa cida-dezinha insignificante
no oeste de Costa Rica. A chuva tinha parado, mas o céu continuava cinzento, com nuvens baixas sobre o aeroporto deserto.
- Sinto muito - disse Rodríguez. - Não podemos providenciar nenhum vôo.
- Mas e o helicóptero que levou aqueles homens há pouco tempo?
- Sim, temos o helicóptero.
- Onde ele está?
- O helicóptero não está aqui.
- Estou vendo, mas onde está? Rodríguez abriu as duas mãos,
- Foi para San Cristóbal.
- Quando vai voltar?
- Eu não sei. Acho que amanhã ou talvez depois de amanhã.
- Senor Rodríguez - ela disse com firmeza. - Preciso estar naquela ilha hoje.
- Compreendo o que a senhora quer - disse Rodríguez. - Mas não posso fazer nada.
- O que o senhor sugere? Rodríguez deu de ombros.
- Eu não poderia dar nenhuma sugestão.
- Não tem um barco que possa me levar?
- Não sei de nenhum barco.
- Isto é um porto. - Ela apontou para as ilhas. - Estou vendo uma porção de barcos.
- Eu sei. Mas não acredito que algum vá até as ilhas. O tempo não está muito favorável.
- Mas e se eu fosse até lá...
- É claro. - Rodríguez suspirou. - É claro que pode perguntar. Assim, um pouco depois das onze horas de uma manhã chuvosa, Sarah Harding estava caminhando
na doca precária de madeira, com a mochila nas costas. Quatro barcos estavam ancorados na doca, que cheirava a peixe, mas todos pareciam vazios. A atividade parecia
se limitar à outra extremidade do porto, onde um barco bem maior estava ancorado. Ao lado do barco, um jipe Vanguard vermelho estava sendo preparado para embarcar,
além de vários grandes tambores de aço e engradados de madeira com suprimentos. Sarah observou o carro, evidentemente adaptado, do tamanho de um Land Rover Defender,
o melhor de todos os veículos para pesquisa de campo. A adaptação do jipe devia ter sido bastante dispendiosa, pensou ela. Só acessível a pesquisadores com muito
dinheiro.
Dois americanos com chapéus de abas largas gritavam e apontavam para o jipe, que foi erguido meio de lado por um guindaste muito antigo e levado para o convés
do barco. Um dos homens gritou: "Cuidado! Cuidado!", quando o jipe pousou com um baque surdo no convés de madeira. "Que droga, tenham cuidado!" Vários carregadores
começaram a levar as caixas para o barco. O guindaste voltou para apanhar os tambores de aço.
Harding se aproximou de um dos homens e perguntou delicadamente:
- Com licença, será que pode me ajudar?
O homem olhou rapidamente para ela. Era de altura mediana, pele avermelhada e traços simpáticos. Parecia tenso, preocupado e pouco à vontade com a roupa nova
de safári.
- Estou ocupado agora - ele disse, dando as costas para Sarah. - Manuel! Tenha cuidado, esse equipamento é delicado!
- Desculpe se o incomodo, mas meu nome é Sarah Harding e estou tentando... - ela insistiu.
- Pode ser até Sarah Bernhardt... Manuel! Mas que droga! - O homem agitou os braços. - Você aí! Sim, você! Segure essa caixa depél
- Estou tentando ir para a Islã Sorna - ela disse, insistindo. Ouvindo isso, o homem mudou completamente. Virou-se
devagar para ela.
- Islã Sorna? - perguntou. - Não teria nenhuma ligação com o Dr. Levine, teria?
- Sim, tenho.
- Ora, vejam só - disse ele com um sorriso largo e acolhedor. - Vejam só! - Estendeu a mão. - Sou Lewis Dodgson, da Biosyn Corporation, de Cupertino. Este
é o meu sócio, Howard King.
- Oi - disse o outro homem, inclinando a cabeça. Howard King era jovem e, pelos padrões da Califórnia, bonito.
Sarah conhecia o tipo: um clássico animal macho beta, subserviente até os ossos. E havia algo estranho no seu comportamento para com ela. Ele se afastou um
pouco e parecia tão pouco à vontade na sua presença quanto Dodgson agora se mostrava amistoso.
- E lá adiante - continuou Dodgson, apontando para o cais - está nosso outro sócio, George Baselton.
Harding viu um homem forte inclinado sobre as caixas que estavam sendo levadas para bordo, com as mangas da camisa molhadas de suor.
- Vocês todos são amigos de Richard? - ela perguntou.
- Estamos indo ao encontro dele, neste momento, para ajudá-lo. - Dodgson hesitou e franziu a testa. - Mas, bem, ele não nos falou a seu respeito...
Então Sarah imaginou qual a impressão que deviam ter dela. Uma mulher pequena, de trinta anos, com uma camisa amassada, short caqui e botas pesadas. A roupa
suja e o cabelo despenteado depois de todo aquele tempo de vôo.
- Eu conheço Richard por Ian Malcolm. Lane eu somos velhos amigos.
- Compreendo... - Continuou a olhar atentamente para ela, como se ainda não tivesse muita certeza.
Sarah achou que devia explicar.
- Eu estive na África. Resolvi vir para cá na última hora. O Dr. Thorne me telefonou.
- Oh, é claro. Thorne. - O homem balançou a cabeça afirmativamente e pareceu mais tranqüilo, como se agora tudo estivesse claro.
- Richard está bem? - ela perguntou.
- Eu espero que sim, porque estamos levando todo este equipamento para ele.
- Vão para Sorna agora?
- Iremos se o tempo continuar assim - disse Dodgson, olhando para o céu. - Estaremos prontos em cinco minutos. Será bem-vinda se quiser vir conosco - disse,
amavelmente. - Teremos prazer em sua companhia. Onde está sua bagagem?
- Tenho só isto - disse ela, erguendo a mochila.
- Viajando com pouco peso, hein? Tudo bem, Srta. Harding, bem-vinda ao grupo.
Ele parecia amável e sincero agora, uma mudança completa da sua atitude do início. Mas ela notou que o homem bonito, King, continuava visivelmente constrangido.
Deu as costas para Sarah e entrou em atividade, gritando com os trabalhadores para que tivessem cuidado com os engradados, onde estava escrito "Biosyn Corporation".
Sarah teve a impressão de que King evitava olhar para ela. E ainda não tinha visto bem o terceiro homem, no convés do barco. Sarah hesitou.
- Tem certeza de que está tudo bem...?
- E claro que sim! Ficaremos encantados - disse Dodgson. - Além disso, de que outro modo você vai chegar lá? Não há aviões. O helicóptero se foi.
- Eu sei, já verifiquei.
- Pois então. Se quiser chegar à ilha, tem de ir conosco. Sarah olhou para o jipe no barco e disse:
- Acho que Thorne já deve estar lá, com o equipamento. Ouvindo isso, o segundo homem virou rapidamente a cabeça, alarmado. Mas Dodgson disse calmamente:
- Sim, acho que sim. Ele partiu ontem à noite, se não me engano.
- Foi o que ele me disse.
- Certo. - Dodgson balançou a cabeça afirmativamente. - Então ele já está na ilha. Pelo menos, espero que esteja.
Ouviram gritos em espanhol e um capitão com um macacão sujo apareceu no convés.
- Senor Dodgson, estamos prontos.
- Ótimo - disse Dodgson. - Excelente. Suba a bordo, Srta. Harding. Vamos embora!

KING


Soltando fumaça negra, o barco pesqueiro saiu do porto para mar aberto. Howard King sentiu a vibração dos motores sob os pés, ouviu o rangido da madeira e
as vozes da tripulação, falando espanhol. Olhou para trás, para Puerto Cortês, um amontoado de casas pequenas à beira d'água. Esperava que aquele maldito barco pudesse
enfrentar o mar - porque estavam lá fora no meio do nada.
E Dodgson estava se aventurando. Desafiando o destino outra vez.
Era a situação que King mais temia.
Howard King conhecia Lewis Dodgson há quase dez anos, desde quando entrara para a Biosyn, recém-formado na Berkeley, um jovem promissor no ramo da pesquisa,
com energia para conquistar o mundo. Sua tese de doutorado foi sobre os fatores de coagulação do sangue. Entrou para a Biosyn numa época em que era imenso o interesse
por esses fatores, que pareciam ser a chave para dissolver os coágulos nos pacientes com ataques cardíacos. Havia uma competição entre as empresas de biotecnologia
para a descoberta de um medicamento capaz de salvar vidas e ao mesmo tempo proporcionar fortunas.
Inicialmente, King trabalhou com uma substância promissora chamada Hemaglutina V-5 ou HGV-5. Nos primeiros testes ela dissolveu, com precisão extraordinária,
a agregação das plaquetas. King tornou-se o jovem pesquisador mais promissor da Biosyn. Seu retrato apareceu com destaque no relatório anual. Tinha um laboratório
próprio e um orçamento de quase meio milhão de dólares.
Então, quando menos esperava, tudo foi por água abaixo. Nos testes preliminares com seres humanos, o HGV-5 não dissolveu os coágulos nem nos casos de enfartes
do miocárdio nem nos de embolia pulmonar. Pior ainda, produziu efeitos colaterais muito graves, hemorragia gastrointestinal, erupções cutâneas, problemas neurológicos.
Depois que um paciente teve convulsões e morreu, a empresa suspendeu os testes. Em poucas semanas, King perdeu seu laboratório para um pesquisador holandês recém-chegado
xxx
que estava desenvolvendo um extrato da saliva da sanguessuga de Sumatra, projeto que parecia mais promissor.
King passou para um laboratório menor, resolveu que estava farto de fatores sangüíneos e voltou sua atenção para os analgésicos. Ele tinha um composto interessante,
o L-isômero de proteína de uma espécie de sapo da África, que parecia ter um efeito narcótico. Mas havia perdido a antiga confiança e, quando a empresa analisou
seu trabalho, concluiu que sua pesquisa não era suficientemente documentada para merecer a aprovação da FDA para o início dos testes. Seu projeto com os sapos com
chifres foi cancelado.
King estava então com trinta e cinco anos e com dois fracassos. Seu retrato já não enfeitava o relatório anual. Correu o boato de que provavelmente seria
despedido no próximo período de avaliação da empresa. Quando ele propôs um novo projeto, foi rejeitado imediatamente. Foi um período ruim da sua vida.
Até o dia em que Lewis Dodgson o convidou para almoçar.
Dodgson tinha uma reputação pouco favorável entre os pesquisadores porque tirava o trabalho de outros, quando estava ainda no começo, e o aprimorava dizendo
que era seu. Antigamente, King jamais permitira que o vissem na companhia de Dodgson. Mas agora permitiu que ele o levasse a um caro restaurante de frutos do mar
em San Francisco.
- A pesquisa é um trabalho duro - Dodgson disse, muito compreensivo.
- Nenhuma novidade - disse King.
- Duro e arriscado - observou Dodgson. - O fato é que pesquisa inovadora raramente tem sucesso. Mas os empresários entendem isso? Não. Se a pesquisa falha,
você é o culpado. Não é justo.
- Está dizendo isso para mim?
- Mas esse é o jogo. - Dodgson deu de ombros e comeu uma perna de caranguejo de casca mole. <
King não disse nada.
- Eu, pessoalmente não gosto de me arriscar - continuou Dodgson. - E todo trabalho original é arriscado. A maior parte das idéias novas não é boa, e a maior
parte do trabalho original fracassa. Essa é a realidade. Se você quer fazer um trabalho original, deve esperar o fracasso. Está tudo bem quando você trabalha numa
universidade, onde o fracasso é louvado e o sucesso leva ao ostracismo. Mas na indústria... não, não. O trabalho original, na indústria, não é uma escolha sensata
para fazer carreira. Só vai criar problemas. Por isso estamos aqui agora, meu amigo.
- O que posso fazer? - disse King.
- Bem, eu tenho a minha versão do método científico que chamo de desenvolvimento de pesquisa focalizada. Se apenas umas poucas idéias forem boas, no fim,
por que tentar descobri-las? É muito difícil. Deixe que outros as descubram, deixe que eles corram o risco, deixe que eles procurem o que chamam de glória. Eu prefiro
esperar e desenvolver as idéias que já demonstraram alguma promessa. Tire o que é bom e faça com que fique melhor. Ou pelo menos faça com que fique suficientemente
diferente para ser patenteado. Então, é minha propriedade. Então, ela me pertence.
King estava atônito. Dodgson admitia francamente que era um ladrão. Não parecia nem um pouco constrangido. King fingiu dar atenção à salada por algum tempo.
- Por que está me contando isso?
- Porque vejo alguma coisa em você. Vejo ambição. Ambição frustrada. Ouça minhas palavras, Howard, você não precisa se sentir frustrado. Não precisa nem mesmo
ser despedido da empresa na próxima avaliação dos trabalhos. O que certamente vai acontecer. Que idade tem seu filho?
- Quatro - disse King.
- E terrível ficar sem trabalho com uma família jovem. E não vai ser fácil conseguir outro emprego. Quem vai lhe dar chance agora? Aos trinta e cinco anos,
um cientista já deixou sua marca, ou nunca mais vai deixar. Não estou dizendo que isso seja certo, mas é como eles pensam.
King sabia que era assim que eles pensavam. Em todas as empresas de biotecnologia da Califórnia.
- Mas, Howard - Dodgson inclinou-se sobre a mesa e abaixou a voz -, um mundo maravilhoso o espera, se resolver ver as coisas de modo diferente. Há um outro
modo de viver sua vida. Francamente, eu acho que deve pensar no que estou dizendo.
Duas semanas depois King passou a ser assistente pessoal de Dodgson no Departamento de Tendências Biogênicas Futuras, que era como a Biosyn chamava o trabalho
de espionagem industrial. E nos anos seguintes, King mais uma vez subiu de conceito na Biosyn - agora porque Dodgson gostava dele.
Agora King tinha todo o equipamento do sucesso. Um Porsche, uma hipoteca, um divórcio, um filho que ele via nos fins de semana. Tudo porque King provou ser
o perfeito segundo em comando, fazendo horas extras, encarregando-se dos detalhes, mantendo seu patrão de fala apressada fora de encrencas. E nesse processo King
veio a conhecer todos os lados de Dodgson - o lado carismático, o lado visionário e o lado impiedoso. King dizia a si mesmo que podia lidar com o lado impiedoso,
que podia controlá-lo, que durante aqueles anos tinha aprendido a fazer isso.
Mas às vezes não tinha certeza.
Como agora.
Porque estavam ali naquele barco de pesca malcuidado e fedido, no meio do oceano, partindo de uma pobre cidadezinha da Costa Rica, e no último e tenso momento
Dodgson tinha resolvido fazer uma espécie de jogo, conhecendo aquela mulher e levando-a com eles.
King não sabia qual era a intenção de Dodgson, mas via nos olhos dele aquele brilho intenso que vira poucas vezes antes e que muito o alarmava.
A mulher, Harding, estava agora no convés de proa, olhando para longe, para o oceano. King viu Dodgson perto do jipe e acenou para ele nervosamente.
- Escute - King disse. - Precisamos conversar.
- Certo - disse Dodgson, com a maior calma. - De que se trata? E ele sorriu. Com aquele sorriso encantador.


HARDING


Sarah Harding olhava para o céu cinzento e ameaçador. O barco balançava nas marolas altas, longe da costa. A tripulação corria para firmar as amarras do jipe
que ameaçava soltar-se a cada movimento mais forte do barco. Ela estava na proa, lutando contra o enjôo. Ao longe, no horizonte, via vagamente a linha escura, o
primeiro sinal da Islã Sorna.
Olhou para trás e viu Dodgson e King debruçados na amurada, no centro do barco, conversando animadamente. King gesticulava, agitado. Dodgson ouvia e balançava
a cabeça. Depois passou o braço pelos ombros de King, tentando acalmá-lo. Os dois ignoravam a atividade em volta do jipe. O que era estranho, pensou ela, considerando
todo o nervosismo demonstrado quando estavam carregando o equipamento. Agora, pareciam não se importar.
Sarah tinha reconhecido o terceiro homem, Baselton, e ficou surpresa por encontrá-lo ali, naquele pequeno barco de pesca. Baselton apertou a mão dela secamente,
quando foram apresentados, e desapareceu na cabine do barco assim que deixaram o porto. Mas talvez estivesse enjoado também.
Continuou a observar os dois homens e viu Dodgson se afastar apressadamente de King para supervisionar o trabalho da tripulação. King verificou as tiras que
prendiam as caixas e os tambores no convés da proa. As caixas onde estava escrito Biosyn.
Harding nunca ouvira falar da Biosyn Corporation. Tentava imaginar qual podia ser a ligação de Richard com ela. Sempre que Ian falava nas empresas de biotecnologia,
fazia-o em tom de crítica, até mesmo de desprezo. E aqueles homens não pareciam do tipo de amigos de Malcolm. Eram rígidos demais, muito... sinistros.
Mas, pensou ela, Ian tinha amigos estranhos que viviam aparecendo no seu apartamento - um calígrafo japonês, um grupo teatral da Indonésia, um malabarista
de Las Vegas com seu bolero brilhante, aquele estranho astrólogo francês que acreditava que a terra era oca... E seus amigos matemáticos. Eram realmente doidos.
Pelo menos pareciam doidos para ela. Tinham uma expressão tão distante, sempre ocupados com suas provas. Páginas e páginas de provas, centenas às vezes. Era tudo
tão abstrato para ela. Sarah Harding gostava de tocar a terra, ver os animais, sentir os sons e os cheiros. Isso era real para ela. Tudo o mais não passava de teorias,
possivelmente certas, possivelmente erradas.
As ondas começaram a bater com força na proa, e ela se afastou um pouco para não se molhar. Bocejou. Não tinha dormido muito nas últimas vinte e quatro horas.
Dodgson terminou o trabalho com o jipe e caminhou em direção a ela.
- Tudo bem? - Sarah perguntou.
- Oh, sim. - Ele sorriu, alegremente.
- Seu amigo King parecia agitado.
- Ele não gosta de barcos. - Inclinou a cabeça, indicando as marolas altas. - Mas estamos indo mais depressa agora. Dentro de uma hora, mais ou menos, estaremos
lá.
- Diga-me, o que é a Biosyn Corporation? - ela perguntou. - Nunca ouvi falar nessa empresa.
- É uma empresa pequena. Fazemos o que chamam de produtos biológicos para o consumidor. Nós nos especializamos em organismos recreativos e esportivos. Por
exemplo, criamos novos tipos de truta e outros peixes. Estamos criando novos tipos de cães, menores, para apartamento. Esse tipo de coisa.
Exatamente o tipo de coisa que Ian detestava, pensou Sarah.
- Como conheceu Ian?
- Oh, há muito tempo - disse Dodgson. Sarah notou a evasiva.
- Quanto tempo?
- Desde os dias do parque.
- O parque - ela disse.

- Ele nunca contou como machucou a perna?
- Não - disse Sarah. - Nunca fala sobre isso. Disse apenas que aconteceu num trabalho de consultoria que estava fazendo... eu não sei. Um problema. Era um
parque?
- Sim, de certo modo. - Dodgson olhou para o mar. Depois de um momento, deu de ombros. - E você? Como o conheceu?
- Ele foi um dos orientadores da minha tese. Sou etologista. Estudo os grandes mamíferos nos ecossistemas da planície do Leste da África. Carnívoros em particular.
- Carnívoros?
- Estou estudando as hienas - disse ela. - Antes, estudei os leões.
- Faz isso há muito tempo?
- Quase dez anos, agora. Seis anos continuamente, desde o meu doutorado.
- Interessante - disse Dodgson, fazendo um gesto afirmativo. - E veio da África para cá?
- Sim, de Seronera. Tanzânia.
Dodgson balançou a cabeça com olhar vago e olhou na direção da ilha, por cima do ombro dela.
- Veja. Parece que o tempo vai melhorar, afinal.
Sarah olhou e viu faixas azuis no manto fino de nuvens. O sol tentava se mostrar. O mar estava mais calmo. E, com surpresa, ela viu a ilha muito mais perto.
Dava para ver os penhascos erguendo-se do mar. Penhascos de rocha vulcânica avermelhada, quase transparentes.
- Tanzânia - disse Dodgson. - Você dirige uma grande equipe de pesquisa?
- Não. Trabalho sozinha.
- Sem alunos?
- Infelizmente, não. Isso porque meu trabalho não é muito atraente. Os grandes carnívoros da savana na África são quase todos noturnos. Desse modo, a minha
pesquisa é feita geralmente à noite.
- Deve ser duro para seu marido.
- Oh, eu não sou casada. - Ela deu de ombros.
- Isso me surpreende. Afinal, uma mulher bonita como você...
- Eu nunca tive tempo - Sarah disse, rapidamente. E para mudar de assunto perguntou: - Onde se pode aportar nesta ilha?
Dodgson olhou para a ilha. Dava para ver as ondas quebrando, altas e brancas, contra a base dos rochedos. Estavam a duas ou três milhas da ilha.
- E uma ilha diferente - disse Dodgson. - Toda a região da América Central é vulcânica. Existem cerca de trinta vulcões ativos entre o México e a Colômbia.
Todas essas ilhas ao largo da costa foram antigamente vulcões ativos, uma parte da cadeia central. Mas, ao contrário do continente, as ilhas estão agora inativas.
Há milhares de anos não há uma erupção.
- Então estamos vendo a parte externa de uma cratera?
- Exatamente. Os rochedos são todos resultado da erosão provocada pela água da chuva, mas o oceano se encarrega da erosão na base dos rochedos. Aquelas partes
planas do rochedo que está vendo são onde o mar desgastou a rocha e áreas enormes da face do rochedo desmoronaram e caíram no mar. Tudo é de rocha vulcânica macia.
- Então, vamos desembarcar...
- Há vários lugares no lado do vento onde o oceano abriu cavernas na rocha. Em dois desses lugares, as cavernas chegam até os rios que correm no interior
da ilha. Portanto, pode-se passar por elas. - Apontou para a frente. - Está vendo ali? Dá para ver uma das cavernas.
Sarah Harding viu uma abertura escura e irregular na base do rochedo. Em volta dela, as ondas quebravam na rocha, a espuma branca subindo a quase quinze metros
de altura.
- Vamos entrar com este barco naquela caverna?
- Se o tempo continuar como está, vamos. - Dodgson olhou para o mar. - Não se preocupe, não é tão ruim quanto parece. Mas... estava falando sobre a África.
Quando saiu da África?
- Logo depois que o Dr. Thorne telefonou. Disse que ia com Ian tentar salvar Richard e perguntou se eu queria ir também.
- E o que você disse?
- Disse que ia pensar. Dodgson pensou por um momento.
- Não disse a ele que viria?
- Não. Não estava certa de querer vir. Quero dizer, estou muito ocupada. Tenho meu trabalho. E era uma longa viagem.
- Por um antigo amor - disse Dodgson, balançando a cabeça compreensivamente.
Sarah suspirou.
- Bem. Você conhece Ian.
- Sim, eu conheço Ian - disse Dodgson. - Um tipo e tanto.
- Esse é um modo de descrevê-lo.
Depois de um silêncio constrangedor, Dodgson disse:
- Estou confuso. A quem exatamente você disse que viria?
- A ninguém. Tomei o primeiro avião e aqui estou.
- Mas e a universidade, seu colegas... Sarah deu de ombros.
- Não tive tempo. E, como eu disse, trabalho sozinha. - Olhou outra vez para a ilha. O rochedo se erguia muito acima do barco. Estavam apenas a uma centena
de metros da costa. A caverna parecia muito maior agora, com as ondas batendo violentamente nos dois lados. Sarah balançou a cabeça. - Parece bastante difícil.
- Não se preocupe - Dodgson disse outra vez. - Veja, o capitão já está indo para a caverna. Assim que entrarmos, estaremos a salvo. E então... Vai ser uma
bela aventura.
O barco balançou e afundou a proa, num movimento incerto. Sarah segurou na amurada com força. Dodgson disse, com um largo sorriso.
- Vê o que eu digo? Uma aventura e tanto, não é? - Ele parecia de repente cheio de energia, agitado mesmo. Esfregou as mãos. - Não precisa se preocupar,
Srta. Harding. Não vou deixar que nada aconteça a...
Sarah não sabia do que ele estava falando, mas, antes que tivesse tempo de perguntar, o barco mergulhou a proa outra vez, espirrando água, e ela cambaleou.
Dodgson se inclinou rapidamente para o lado - como para evitar que ela caísse -, mas aparentemente alguma coisa saiu errada - o corpo dele bateu nas pernas de Sarah,
levantando-a -, outra onda os atingiu e Sarah dobrou o corpo, gritou e agarrou na amurada. Mas tudo estava acontecendo depressa demais, o mundo virou de cabeça para
baixo e girou em volta dela, sua cabeça bateu na amurada e então ela se viu caindo, despencando no espaço. Viu a tinta descascada da proa do barco passar por ela,
viu o oceano verde erguendo-se à sua frente e um frio gelado a envolveu quando mergulhou no mar encapelado e afundou na escuridão.

O VALE


- Tudo está indo muito bem - disse Levine, esfregando as mãos.
- Melhor do que eu esperava, devo dizer. Estou muito satisfeito.
Estava no posto de observação com Thorne, Eddie, Malcolm e os meninos, olhando para o vale lá embaixo. Todos estavam transpirando dentro da pequena casa no
alto do andaime, no ar quente e parado do meio-dia. Em volta deles, a planície de relva estava deserta. A maioria dos dinossauros tinha se retirado para a sombra
fresca das árvores.
A única exceção era o bando de apatossauros que deixou as árvores e voltou ao rio para beber outra vez. Os animais enormes formavam um grupo compacto na margem
do rio. Perto dali, porém mais espalhados, estavam os parassauros, os menores mais próximos do bando de apatossauros.
Thorne enxugou o suor da testa e perguntou:
- Com o quê, exatamente, estão tão satisfeitos?
- Com o que estamos vendo aqui. - Malcolm consultou o relógio e escreveu alguma coisa no seu bloco de anotações. - Estamos conseguindo os dados de que precisávamos.
É muito excitante.
Thorne bocejou. O calor dava sono.
- Por quê? Os dinossauros estão tomando água. O que há de especial nisso?
- Estão bebendo outra vez - corrigiu Levine. - Pela segunda vez numa hora. No meio do dia. Essa absorção de líquido é extremamente sugestiva das estratégias
termorreguladoras usadas por essas enormes criaturas.
- Quer dizer que eles bebem bastante para não sentir calor - disse Thorne, sempre impaciente com qualquer terminologia pedante.
- Sim. É evidente que sim. Eles bebem muito. Mas na minha opinião, sua volta ao rio pode ter outro significado completamente diferente.
- Qual?
- Ora, ora. - Levine apontou para os animais. - Olhe para as manadas. Veja como estão dispostas em termos de espaço. Estamos vendo uma coisa que ninguém jamais
viu antes ou sequer suspeitou em se tratando de dinossauros. Estamos vendo nada mais, nada menos do que uma simbiose entre as espécies.
- Estamos vendo isso?
- Sim - afirmou Levine. - Os apatossauros e os parassauros estão juntos. Eu os vi juntos ontem também. Aposto que sempre ficam juntos quando estão na planície
aberta. Sem dúvida, vocês estão se perguntando por quê.
- Sem dúvida - disse Thorne.
- O motivo - explicou Levine - é que os apatossauros são muito fortes mas têm a visão fraca, ao passo que os parassauros são menores, mas têm visão muito
aguda. Assim as duas espécies ficam juntas para a defesa mútua. Exatamente como as zebras e os babuínos ficam juntos na planície africana. A zebra tem bom faro e
os babuínos boa visão. Juntos, são mais eficazes contra os predadores.
- E você acha que isso também acontece com os dinossauros porque...
- É perfeitamente óbvio - disse Levine. - Observe o comportamento deles. Quando as duas manadas estão separadas, formam grupos fechados. Mas, quando estão
juntas, os parassauros se espalham, abandonando sua formação para formar um anel em volta dos apatossauros. Exatamente como estão agora. Isso só pode significar
que cada parassauro vai ser protegido pelo bando dos apatossauros e vice-versa. Só pode ser uma defesa mútua contra predadores.
Um dos parassauros levantou a cabeça e olhou para a outra margem do rio. Todos os outros parassauros fizeram o mesmo. Os apatossauros continuaram a beber
e apenas um ou dois adultos levantaram o pescoço.

No calor do meio-dia, os insetos zumbiam em volta deles. Thorne disse:
- Então, onde estão os predadores?
- Bem ali. - Malcolm apontou para um grupo de árvores no outro lado do rio, não muito distante da água.
Thorne olhou e não viu nada.
- Não está vendo?
- Não.
- Continue olhando. São animais pequenos parecidos com lagartos. Marrom-escuros. Raptores - disse Malcolm.
Thorne deu de ombros. Não via nada. Levine, ao lado dele, começou a comer uma barra de alimento energético. Preocupado em segurar o binóculo, deixou cair
o papel no assoalho da pequena casa. Pedaços do papel voaram para baixo, para o chão.
- Que tal essa coisa? - Arby perguntou.
- E boa. Um pouco açucarada.
- Tem mais?
Levine procurou nos bolsos e deu uma barra para Arby que a partiu ao meio e deu a metade para Kelly. Ele desembrulhou sua metade cuidadosamente, dobrou o
papel e guardou no bolso.
- Vocês compreendem a importância disso? - perguntou Malcolm. - Para a questão da extinção. Já é evidente que a extinção dos dinossauros é um problema muito
mais complexo do que julgávamos até agora.
- É mesmo? - perguntou Arby.
- Bem, pense um pouco. Todas as teorias sobre extinção têm como base os registros fósseis. Mas esses registros não mostram o tipo de comportamento que estamos
vendo aqui. Não registram a complexidade da interação dos grupos.
- Porque os fósseis são apenas ossos - disse Arby.
- Certo. E ossos não têm comportamento algum. Pensando bem, o registro fóssil é como uma série de fotografias, momentos congelados de uma realidade móvel
e viva. Olhar os registros fósseis é como folhear um álbum de retratos de família. Sabemos que o álbum não é completo. Sabemos que a vida aconteceu entre as fotos.
Mas não temos registro do que aconteceu, temos somente as fotos. Então, nós as estudamos e estudamos. E logo começamos a pensar no álbum não como uma série de momentos,
mas como a própria realidade. E começamos a explicar tudo em termos do álbum e esquecemos da realidade que está por baixo das fotos.
- E a tendência - continuou Malcolm - tem sido pensar em termos dos fatos físicos. Supomos que algum fato físico externo tenha sido responsável pela extinção.
Um meteoro que atinge a Terra e altera a temperatura. Ou vulcões entram em erupção e mudam a temperatura. Ou um meteoro provoca a erupção dos vulcões e muda a temperatura.
Ou a vegetação muda, os animais morrem de fome e são extintos. Ou surgem plantas que envenenam todos os dinossauros. Em cada caso, o que se imagina é sempre um evento
externo. Mas o que ninguém imagina é que os próprios animais tenham mudado - não nos ossos, mas de comportamento. Contudo, olhando para animais como aqueles e vendo
o modo complexo como seu comportamento se entrelaça, compreendemos que uma mudança no comportamento do grupo pode facilmente levar à extinção.
- Mas, por que haveria uma mudança no comportamento do grupo? - perguntou Thorne. - Se não houvesse nenhuma catástrofe externa, o comportamento teria mudado?
- Na realidade - disse Malcolm - o comportamento está sempre mudando. Nosso planeta é dinâmico. O clima está mudando. A Terra está mudando. Os continentes
se movem lentamente. Oceanos aumentam e diminuem. Montanhas surgem do solo e são desfeitas pela erosão. Todos os organismos do planeta estão se adaptando constantemente
a essas mudanças. Os melhores são os que se adaptam com maior rapidez. Por isso é difícil compreender como uma catástrofe que produz uma grande mudança pode causar
a extinção, uma vez que grandes mudanças estão acontecendo o tempo todo.
- Nesse caso - disse Thorne -, o que causa a extinção?
- Certamente não uma mudança rápida, os fatos nos dizem isso claramente - respondeu Malcolm.
- Quais fatos?
- Cada mudança ambiental importante quase sempre foi acompanhada por uma onda de extinção - mas não imediatamente. As extinções ocorrem centenas de milhares
de anos depois. As geleiras desceram, o clima mudou drasticamente, mas os animais não morreram. Só depois que as geleiras recuaram, quando se pensava que tudo ia
voltar ao normal, várias espécies começaram a ser extintas. Foi quando as girafas, tigres e mamutes desapareceram do continente americano. E esse é o padrão comum.
E quase como se as espécies tivessem enfraquecido por causa da grande mudança, mas só vieram a morrer muitos anos depois. É um fenômeno perfeitamente aceito e observado.
- E como se explica? Levine ficou calado.
- Não há explicação - disse Malcolm. - É um mistério paleontológico. Mas acredito que a teoria da complexidade possa nos dizer muita coisa. Porque se o conceito
da vida no limite do caos é verdadeiro, então uma grande mudança leva os animais para mais perto dessa margem. Desestabiliza todo tipo de comportamento. E, quando
o meio ambiente volta ao normal, não é na verdade uma volta ao normal. Em termos de evolução, é outra grande mudança e forte demais para ser acompanhada. Acho que
o novo comportamento das populações pode surgir de modos inesperados e acho que sei por que os dinossauros...
- O que é aquilo? - perguntou Thorne.
Ele estava olhando para as árvores e viu um dinossauro saltar para a clareira. Era magro, movia-se agilmente apoiado nas patas traseiras, mantendo o equilíbrio
com a cauda rígida. Tinha quase dois metros de altura, era marrom-escuro com listras vermelhas, como um tigre.
- Aquilo... é um velocirraptor - disse Malcolm. Thorne voltou-se para Levine.
- Foi isso que o fez subir na árvore? Parece muito feio.
- Eficiente - disse Levine. - Esses animais são máquinas mortíferas brilhantemente construídas. Sem dúvida é o predador mais eficiente da história do planeta.
Aquele que acaba de sair da selva deve ser o animal alfa. Ele guia o grupo.
Thorne viu outro movimento debaixo das árvores.
- Há outros.
- Oh, sim - disse Levine. - Este grupo é muito grande. - Apanhou o binóculo. - Eu gostaria de localizar seu ninho. Não o encontrei em nenhum lugar da ilha.
É claro que eles procuram se esconder muito bem, mas mesmo assim...
Os parassauros estavam gritando estridentemente, chegando mais perto do bando de apatossauros. Mas os grandes apatossauros pareciam relativamente indiferentes.
Os adultos que estavam mais próximos da água chegaram a dar as costas para o raptor.
- Eles não se importam? - perguntou Arby. - Não estão nem olhando para ele.
- Não se deixe enganar - disse Levine. - Os apatossauros se importam e muito. Podem parecer vacas gigantes, mas não são nada disso. Aquelas caudas têm dez
metros de comprimento e pesam algumas toneladas. Vejam com que rapidez eles as balançam. Uma pancada com aquela cauda pode quebrar as costas do atacante.
- Então, dar as costas faz parte da sua defesa?
- Sem dúvida. E pode-se ver que o pescoço longo ajuda a manter o equilíbrio da cauda.
As caudas dos adultos eram tão longas que chegavam até a outra margem do rio. Eles as balançavam de um lado para o outro, os parassauros gritavam e o raptor
que vinha na frente voltou para as árvores. Logo depois, todo o grupo começou a se afastar, seguindo a margem da floresta, na direção das colinas.
- Parece que você estava certo - disse Thorne. - As caudas espantaram os raptores.
- Quantos você pode contar? - perguntou Levine.
- Não sei. De dez a doze. Posso ter deixado passar alguns.
- Quatorze. - Malcolm anotou no seu caderno.
- Quer segui-los? - perguntou Levine.
- Agora não.
- Podemos ir no Explorer.
- Talvez mais tarde - disse Malcolm.
- Acho que precisamos saber onde fica o ninho deles - insistiu Levine. - É essencial, Ian, se vamos determinar o relacionamento predador-presa. Nada é mais
importante do que isso. E esta é a oportunidade perfeita para seguir...
- Talvez mais tarde - disse Malcolm, consultando o relógio outra vez.
- É a centésima vez que você consulta as horas hoje - disse Thorne.
Malcolm deu de ombros.
- Está quase na hora do almoço. A propósito, e Sarah? Ela não devia estar chegando?
- Sim. Imagino que deva chegar a qualquer momento - disse Thorne.
Malcolm enxugou o suor da testa.
- Está quente aqui em cima.
- Sim, está quente.
Ouviam o zumbido dos insetos no sol enquanto observavam a retirada dos raptores.
- Sabe o que estou pensando? - disse Malcolm. - Acho que devemos voltar.
- Voltar? - exclamou Levine. - E as nossas observações? E as outras câmeras que queremos instalar e...
- Eu não sei, talvez fosse bom descansar um pouco. Levine olhou incrédulo para ele mas não disse nada. Thorne e os meninos olharam também para Malcolm, em
silêncio.
- Bem, eu acho - disse Malcolm - que, como Sarah está vindo de tão longe, da África, devemos estar lá para recebê-la. - Deu de ombros. - Acho que seria uma
simples cortesia.
- Eu não sabia que... - disse Thorne.
- Não, não - Malcolm disse, rapidamente. - Não é nada disso. É só que... Você sabe, talvez ela nem venha... - de repente pareceu incerto. Ela disse que viria?
- Disse que ia pensar. Malcolm franziu a testa.
- Então ela vem. Se Sarah disse isso, ela vem. Eu a conheço. Então, querem voltar agora?
- E claro que não - disse Levine, ainda olhando com o binóculo. - Eu nem pensaria em sair daqui agora.
- Thorne? Quer voltar? - Malcolm perguntou.
- Claro. - Thorne estava enxugando o suor da testa. - Está quente.
- Se eu conheço Sarah - disse Malcolm, descendo pelo andaime -, ela vai chegar a esta ilha maravilhosa como sempre.

A CAVERNA


Com esforço ela chegou à superfície, mas tudo o que viu foi água - ondas de quatro metros erguiam-se acima da sua cabeça por todos os lados. Era imensa a
força do oceano. O movimento da água a levava para a frente e para trás, e ela não tinha forças para resistir. Não via o barco, só o mar com a espuma branca das
ondas. Não via a ilha, só água. Só água. Lutou contra a tremenda sensação de pânico.
Tentou bater as pernas contra a corrente, mas suas botas pareciam de chumbo. Mergulhou outra vez e voltou à superfície respirando avidamente. Precisava tirar
as botas. Respirou, prendeu o ar, mergulhou a cabeça e tentou desatar os cordões das botas. Seus pulmões queimavam. O oceano a levava de um lado para o outro incessantemente.
Tirou uma das botas, voltou para respirar e mergulhou a cabeça outra vez. Com os dedos rígidos de frio e de medo, começou a desatar o cordão do outro pé.
No fim do que para ela pareceram horas, suas pernas estavam livres e leves, e ela começou a mover os braços e as pernas para ficar na superfície. O movimento do
mar a levantava e deixava cair. Ela não via a ilha. Sentiu pânico outra vez. Então avistou a ilha.
Os penhascos nus estavam assustadoramente próximos. As ondas batiam com estrondo nas rochas. Ela não estava a mais de cinqüenta metros da costa, levada inexoravelmente
pelas ondas para as pedras. Quando a onda seguinte a ergueu, viu a caverna, cem metros à sua direita. Tentou nadar para ela, mas era impossível. Não tinha forças
para fazer nenhum movimento naquele mar cncapelado. Só sentia a força do mar, levando-a para os rochedos.
O pânico acelerou seu coração. Sabia que seria morta instantaneamente. Uma onda se ergueu sobre sua cabeça, ela engoliu água e tossiu. Sua vista ficou turva.
Sentiu náusea e um terror profundo.
Abaixou a cabeça na água e começou a nadar, uma braçada depois da outra, batendo os pés com a maior força possível. Não tinha a sensação de movimento, só
a força da corrente puxando-a para o lado. Não ousava olhar para cima. Continuou a nadar. Quando ergueu a cabeça para respirar, viu que tinha avançado um pouco -
não muito, mas um pouco - para o norte. Estava mais perto da caverna.
Isso a animou, mas continuava apavorada. Estava perdendo as forças. Seus braços e suas pernas doíam com o esforço, os pulmões estavam em fogo. A respiração
curta e áspera. Tossiu outra vez, respirou fundo, abaixou a cabeça e continuou a nadar.
Mesmo com a cabeça na água ela ouvia o rugido surdo das ondas contra o rochedo. Nadou com todas as forças. A corrente e as ondas a levavam para a direita
e para a esquerda, para a frente e para trás. Era inútil. Mesmo assim ela tentou.
Aos poucos a dor aguda nos músculos se transformou numa dor surda e contínua. Era como se tivesse vivido com ela toda a sua vida. Já não a notava mais. Continuou
a nadar, sem pensar em nada.
Quando a marola a levantou outra vez, ergueu a cabeça para respirar. Surpresa, viu que a caverna estava muito perto. Mais algumas braçadas, a água a carregaria
para dentro. Imaginou que na caverna a corrente devia ser mais fraca. Mas não era, nos dois lados da entrada, as ondas altas batiam com força, subindo pela rocha
e voltando no repuxo. O barco não estava em lugar algum.
Abaixou a cabeça outra vez e nadou, usando suas últimas forças, e de repente uma marola imensa a apanhou, erguendo-a e levando-a para as pedras. Já não tinha
forças para resistir. Levantou a cabeça e viu que tudo estava escuro.
Exausta e dolorida, compreendeu que estava dentro da caverna. O mar a havia levado para a caverna! O som das ondas ecoava nas paredes de pedra. Estava escuro
demais para ver alguma coisa. A corrente a levava cada vez mais para dentro com uma força incrível. Ofegante, ela tentou nadar numa direção, mas não conseguia. Bateu
contra as rochas, sentiu uma dor lancinante e foi carregada para o interior da caverna. Mas agora havia uma diferença. Via uma luz fraca no teto e a água em volta
dela parecia brilhar. A força do mar diminuiu. Era mais fácil manter a cabeça fora da água. Viu luz à frente, brilhante e quente - o fim da caverna.
Então, de repente, foi carregada para a luz do sol e para o ar livre. Estava no meio de um rio largo e lamacento, rodeado por folhagem densa. O ar era quente
e parado. Ouviu as vozes distantes dos pássaros.
Além de uma curva do rio ela viu a popa do barco de Dodgson, já ancorado. Não via ninguém no barco e não queria ver.
Reunindo as forças que restavam, ela nadou para a margem e agarrou os arbustos cerrados. Fraca demais, passou o braço em volta de uma raiz e deitou de costas
na corrente suave, olhando para o céu, tentando fazer a respiração voltar ao normal. Não sabia quanto tempo ficou assim até sentir que as forças voltavam. Segurando
nas raízes, subiu para a margem, até chegar a uma abertura na folhagem, que dava para uma praia lamacenta adiante. Quando se arrastou para o alto da margem escorregadia,
notou várias pegadas grandes na lama. Eram estranhas, marcas de pés de três dedos, cada um terminando numa garra longa...
Abaixou para examinar as pegadas e sentiu a terra vibrar, tremer sob suas mãos. Uma sombra enorme desceu sobre ela e, ao erguer os olhos, viu atônita a barriga
pálida e encouraçada de um animal enorme. Estava fraca demais para reagir, até para levantar a cabeça.
A última coisa que viu foi um pé enorme de pele dura como couro pousar ao seu lado, remexendo a lama e ao mesmo tempo ouviu um ronco baixo e surdo. Então,
de repente, dominada pela exaustão, Sarah Harding perdeu as forças e caiu deitada de costas. Fechou os olhos e desmaiou.

DODGSON


Poucos metros acima da margem do rio, Lewis Dodgson subiu no jipe Wrangler feito sob encomenda e bateu a porta. Ao lado dele, Howard King retorcia as mãos,
nervoso.
- Como pôde fazer aquilo com ela? - King perguntou.
- Fazer o quê? - perguntou George Baselton, no banco de trás.
Dodgson não respondeu. Girou a chave e ligou o motor. Engrenou a marcha no carro de tração nas quatro rodas e começaram a subir a colina na direção da selva,
afastando-se do barco e da margem do rio.
- Como pôde? - repetiu King, agitado. - Meu Deus.
- O que aconteceu foi um acidente - disse Dodgson.
- Um acidente? Um acidente ?
- Isso mesmo, um acidente - repetiu Dodgson, calmo. - Ela caiu na água.
- Eu não vi nada - disse Baselton. King balançou a cabeça.
- Jesus, e se alguém vier investigar e...
- E daí? - interrompeu Dodgson. - O mar estava revolto, ela estava de pé na proa, uma onda enorme nos atingiu, e ela foi atirada para fora do barco. Não sabia
nadar muito bem. Navegamos em círculo à procura dela, mas não encontramos. Um acidente muito infeliz. Então, por que está preocupado?
- Por que estou preocupado?
xxx
- Sim, Howard. Exatamente por que merda você está preocupado?
- Pelo amor de Deus, eu vi...
- Não, não viu - disse Dodgson.
- Eu não vi nada - Baselton disse outra vez. - Eu fiquei na cabine o tempo todo.
- Ótimo para você - disse Howard King. - Mas e se houver uma investigação?
O jipe saltava na estrada de terra, cada vezmais se embrenhando na selva.
- Não vai haver - garantiu Dodgson. - Ela deixou a África apressadamente e não disse a ninguém para onde ia.
- Como você sabe? - perguntou King, com voz estridente.
- Sei porque ela me disse, Howard. É por isso que eu sei. Agora apanhe o mapa e pare de choramingar. Você sabia o que íamos fazer quando resolveu vir comigo.
- Eu não sabia que você ia matar alguém, pelo amor de Deus...
- Howard - Dodgson suspirou. - Não vai acontecer nada. Apanhe o mapa.
- Como você sabe?
- Porque sei o que estou fazendo, é por isso. Ao contrário de Malcolm e Thorne, que estão em algum lugar desta ilha, rodando por aí, fazendo não sei que bobagem
nesta maldita selva.
A menção aos dois cientistas criou uma nova preocupação. King disse, mais nervoso ainda.
- Talvez a gente os encontre...
- Não, Howard, não vamos encontrar. Eles nunca vão saber que estamos aqui. Não vamos ficar mais de quatro horas, lembre-se disso. Desembarcar à uma hora.
De volta ao barco às cinco. No porto de Costa Rica às sete. Em San Francisco à meia-noite. Pronto. Feito. Finito. E finalmente, depois de todos esses anos, vou ter
o que devia ter conseguido anos atrás.
- Embriões de dinossauros - disse Baselton.
- Embriões? - King perguntou, surpreso.
- Oh, não estou mais interessado em embriões - disse Dodgson. - Anos atrás, tentei conseguir embriões congelados, mas não preciso me preocupar com isso agora.
Quero ovos fertilizados. E em quatro horas eu terei ovos de todas as espécies que existem nesta ilha.
- Como pode fazer isso em quatro horas?
- Posso porque já sei o local exato de cada ninho de dinossauro na ilha. O mapa, Howard.
King abriu o mapa. Era uma carta topográfica grande de 30 por 90 cm mostrando elevações do terreno com contornos azuis. Em vários lugares nos vales, havia
uma densa concentração de círculos vermelhos. Em alguns lugares, grupos de círculos.
- O que é isto? - perguntou King.
- Por que não lê o que está escrito? - disse Dodgson.
King leu a legenda.
- Sigam data Landsat/Nordstat misto spectra VSFR/FASLR/ IFFVR. E depois uma porção de números. Não, espere. Datas.
- Correto - disse Dodgson. - Datas.
- Datas das passagens? Isto é uma carta resumida combinando os dados de várias passagens do satélite?
- Correto.
King continuou a examinar o mapa.
- E parece... espectro visível e abertura falsa de radar e... o quê?
- Infravermelho. VR termal de banda larga. - Dodgson sorriu. - Fiz tudo isso em duas horas mais ou menos. Copiei todos os dados do satélite, fiz um resumo
e consegui as respostas que eu queria.
- Já compreendi - disse King. - Esses círculos vermelhos são como assinaturas infravermelhas.
- Sim - disse Dodgson. - Animais grandes deixam grandes marcas. Apanhei todas as passagens do satélite por esta ilha nos últimos anos e fiz um mapa dos locais
das fontes de calor. E os locais se sobrepõem de passagem para passagem, o que é indicado pelas marcas vermelhas concêntricas. Significa que os animais tendem a
se localizar em determinados lugares. Por quê? - Olhou para King. - Porque é aí que estão os ninhos.
- Sim, deve ser - disse Baselton.
- Pode ser onde eles comem - observou King. Dodgson balançou a cabeça, irritado.
- É óbvio que esses círculos não podem indicar os lugares em que eles comem.
- Por que não?
- Porque esses animais pesam em média vinte toneladas cada um. Se você tiver um bando de dinossauros, terá um total de biomassa com mais de duzentos e cinqüenta
mil quilos andando pela floresta. Tantos animais desse tamanho comem uma enorme quantidade de plantas num dia. E o único modo de fazer isso é manter-se em movimento.
Certo?
- Acho que...
- Você acha? Olhe à sua volta, Howard. Está vendo alguma parte da floresta sem vegetação? Não, não está. Eles comem as folhas de algumas árvores e seguem
em frente. Acredite em mim, esses animais têm de se mover para se alimentar. O que eles não mudam são os locais dos ninhos. Portanto, os círculos vermelhos devem
indicar onde estão os ninhos. - Olhou para o mapa. - E, a não ser que eu me engane, o primeiro ninho fica logo depois desta subida, na encosta do outro lado.
O jipe derrapou numa poça de lama e seguiu em frente, subindo a colina.

O CHAMADO


No posto de observação, lá no alto, Levine observava os bandos de dinossauros com o binóculo. Malcolm tinha voltado para o trailer com os outros e ele estava
sozinho. Na verdade foi um alívio para Levine. Estava muito satisfeito em poder observar aqueles animais e sabia que Malcolm não compartilhava seu entusiasmo. Malcolm
sempre parecia estar pensando em outra coisa. E não tinha paciência para observar por muito tempo - ele queria analisar os dados, não coletá-los.
É claro que, entre os cientistas, isso representava uma diferença bastante conhecida de personalidade. A física era um exemplo perfeito. Os experimentalistas
e os teóricos viviam em mundos diferentes, trocando artigos científicos entre eles, mas na realidade com pouca coisa em comum. Era quase como se estudassem matérias
diferentes.
E no caso de Levine e Malcolm, a diferença na abordagem da ciência apareceu logo no começo, quando estavam emSanta Fé. Os dois estavam interessados na extinção,
mas Malcolm abordava a matéria de um modo geral, de um ponto de vista matemático. Seu distanciamento, suas fórmulas inexoráveis haviam fascinado Levine, e os dois
homens iniciaram um intercâmbio informal em almoços freqüentes. Levine ensinava paleontologia para Malcolm e Malcolm ensinava matemática molecular para Levine. Começaram
a esboçar algumas conclusões que os entusiasmaram. Mas começaram também a discordar. Mais de uma vez pediram a eles que saíssem do restaurante. Então saíam para
o calor da rua Guadelupe e caminhavam para o rio, discutindo aos gritos, fazendo os turistas, assustados, passarem para a outra calçada.
No fim, suas diferenças eram de personalidade. Malcolm achava Levine pedante e minucioso demais, preocupado com detalhes sem importância. Levine jamais via
o quadro geral. Nunca dava atenção às conseqüências das suas ações. Levine, por seu lado, não hesitava em chamar Malcolm de imperioso e desligado, indiferente aos
detalhes.
- Deus está nos detalhes - Levine lembrou certa vez.
- Talvez o seu Deus - respondeu Malcolm. - Não o meu. O meu está no processo.

No seu posto de observação, Levine pensou que respostas eram exatamente o que se podia esperar de um matemático. Para ele os detalhes eram tudo, pelo menos
em biologia, e, na sua opinião, a falha mais comum dos seus colegas biólogos era a falta de atenção aos detalhes.
Levine vivia para os detalhes e não podia passar sem eles. Como o caso do animal que o havia atacado e a Diego. Levine pensava freqüentemente nele, lembrando
tudo o que havia acontecido. Porque alguma coisa o intrigava, uma impressão que não conseguia definir.
O animal atacou rapidamente e ele teve a impressão de ser uma forma básica de terópodos - pernas traseiras, cauda rígida, cabeça grande, o de sempre - mas
no breve instante em que chegou a ver a criatura, parecia haver algo diferente ao redor das órbitas que o fazia pensar no Carnotaurus sastrei. Da formação Gorro
Frigo, na Argentina. Além disso, a pele era muito estranha. Parecia de um verde mosqueado, mas havia algo que...
Levine deu de ombros. A idéia estava no fundo de sua mente, mas não conseguia decifrá-la. Simplesmente não conseguia.

Com relutância, Levine voltou a observar o bando de parassauros, ao lado do rio, perto dos apatossauros. De onde estava, ouvia os barridos típicos dos parassauros.
Notou que a maioria deles emitia um som de curta duração, uma espécie de grasnado rouco. Às vezes vários animais faziam o som ao mesmo tempo, ou quase se sobrepondo
um ao outro, de modo que isso parecia ter por fim indicar ao bando onde estava cada um. Havia também um barrido mais longo, mais dramático e menos freqüente, só
emitido pelos animais maiores, que erguiam as cabeças e soltavam o urro alto e longo. Mas o que significa esse som?
De pé, ao sol, Levine resolveu fazer uma pequena experiência. Com as mãos em concha nos lados da boca, imitou o grito do parassauro. Não foi uma imitação
muito boa, mas imediatamente o parassauro que parecia ser o líder do bando ergueu a cabeça e olhou para um e para outro lado. Então respondeu com um grito baixo.
Levine chamou outra vez.
O parassauro tornou a responder.
Levine ficou feliz e anotou o fato no caderno. Mas quando olhou outra vez, viu com surpresa que o bando todo se afastou dos apatossauros, formou uma fila
indiana e começou a andar diretamente para o abrigo onde ele estava.
Levine começou a suar.
O que tinha feito? Uma idéia maluca passou por sua cabeça. Teria imitado o chamado para o acasalamento? Era só o que faltava, ser atacado por um dinossauro
no cio. Quem poderia saber como aqueles animais se comportavam nessas horas? Com ansiedade crescente, ele os viu prosseguir na marcha. Talvez fosse bom chamar Malcolm
e pedir conselho. Mas compreendeu que, ao imitar o grito do parassauro, ele tinha interferido no meio ambiente, introduzindo uma nova variante. Tinha feito exatamente
o que dissera a Thorne que não pretendia fazer. Um ato impensado, sem dúvida. E certamente não muito importante na ordem das coisas. Mas Malcolm na certa ia ficar
furioso com ele.
Levine abaixou o binóculo e continuou a olhar. Um barrido profundo ecoou no ar, tão alto que feriu seus tímpanos. O chão começou a tremer e o abrigo no alto
do andaime balançou perigosamente.
Meu Deus, pensou ele. Estão vindo direto para mim. Levine se abaixou e procurou o rádio na mochila que estava no chão.

PROBLEMAS DA EVOLUÇÃO


No trailer, Thorne tirou a comida reidratada do microondas e distribuiu os pratos em volta da pequena mesa. Todos começaram a comer. Malcolm espetou a comida
com o garfo.
- O que é esta coisa? - ele perguntou.
- Peito de frango cozido com ervas - disse Thorne. Malcolm experimentou e balançou a cabeça.
- A tecnologia não é maravilhosa? Consegue imitar exatamente o gosto do papelão.
Malcolm olhou para os meninos que comiam com apetite. Kelly apontou com o garfo para os livros presos na estante ao lado da mesa.
- Tem uma coisa que eu não entendo - ela disse.
- Só uma? - disse Malcolm.
- Todo esse negócio sobre evolução. Darwin escreveu seu livro há muito tempo, certo?
- Darwin publicou A origem das espécies em 1859 - disse Malcolm.
- E até hoje todo o mundo acredita na sua teoria, certo?
- Acho que seria mais justo dizer que todos os cientistas do mundo concordam com a idéia de que a evolução é o futuro da vida na Terra - disse Malcolm. -
Eque descendemos de antepassados animais. Sim.
- Tudo bem - disse Kelly. - Então, por que todo esse auê agora?
- Todo esse auê - Malcolm sorriu - é porque todos concordam com o fato da evolução mas ninguém sabe como ela ocorre.
A teoria tem grandes problemas. E é cada vez maior o número de cientistas que admite isso. ..

Malcolm empurrou o prato.
- Temos de seguir o caminho da teoria até uns duzentos anos atrás. Começando com o barão Georges Cuvier, o mais famoso anatomista na sua época, que vivia
no centro intelectual do mundo, Paris. Por volta de 1800, ossos antigos começaram a ser desenterrados e Cuvier compreendeu que pertenciam a animais que já não existiam
na Terra. Isso era um problema porque em 1800 a crença geral era que todas as espécies animais criadas viviam ainda. A idéia parecia lógica porque naquele tempo
acreditavam também que a idade da Terra era de apenas alguns milhares de anos. E porque Deus, que havia criado todos os animais, jamais permitiria que suas criaturas
fossem extintas. Assim, a extinção era impossível. Cuvier estudou a fundo os ossos encontrados e concluiu que, com Deus ou sem Ele, muitos animais estavam extintos
- como resultado, pensava ele, de catástrofes mundiais, como o dilúvio de Noé.
- Tudo bem...
- Então Cuvier, embora com relutância, teve de acreditar na extinção - continuou Malcolm -, mas jamais aceitou a evolução. Para Cuvier, a evolução não podia
acontecer. Alguns animais morriam e alguns sobreviviam, mas nenhum evoluía. Na sua opinião, os animais não mudavam. Então surgiu Darwin dizendo que os animais evoluem
e que os ossos encontrados eram na verdade dos antepassados extintos dos animais vivos. As implicações da teoria de Darwin desagradaram a muita gente. Não queriam
admitir a mudança na criação de Deus e não gostavam da idéia de ter macacos nas suas árvores genealógicas. Além de embaraçoso, era um insulto. O debate foi acalorado.
Mas Darwin apresentou uma quantidade enorme de dados reais - ele tinha um caso arrasador. Assim, gradualmente, sua idéia da evolução começou a ser aceita pelos cientistas
e pelo mundo em geral. Mas permanecia a questão: Como ocorre a evolução? Para isso Darwin não tinha uma boa resposta.
- Seleção natural - disse Arby.
- Sim, essa foi a explicação dada por Darwin. O meio ambiente exerce uma pressão que favorece alguns animais que se reproduzem com maior freqüência em gerações
sucessivas e é assim que ocorre a evolução. Porém, como muitas pessoas concluíram, a seleção natural não é na verdade uma explicação. É uma definição. Se um animal
é favorecido, ele foi escolhido para isso. Mas o que é favorecido no animal? E como a seleção natural funciona realmente? Darwin não tinha idéia. E ninguém tentou
dar uma resposta durante outros cinqüenta anos.
- Mas são os genes - disse Kelly.
- Tudo bem - concordou Malcolm. - Ótimo. Chegamos ao século XX. O trabalho de Mendel com as plantas é redescoberto. Fischer e Wright estudam as populações.
Logo ficamos sabendo que os genes controlam a hereditariedade - seja lá o que for um gene. Não esqueçam que na primeira metade do século, durante todo o tempo da
Primeira e da Segunda Guerras Mundiais, ninguém tinha idéia do que era um gene. Depois de Watson e Crick, em 1953, ficamos sabendo que os genes são núcleotídeos
dispostos numa dupla hélice. Ótimo. E ficamos sabendo também sobre mutação. Assim, na segunda metade do século XX, temos uma teoria da seleção natural segundo a
qual as mutações surgem espontaneamente nos genes, que o meio ambiente favorece as mutações que são benéficas e que desse processo de seleção ocorre a evolução.
É simples e direto. Sem interferência de Deus. Nenhum princípio organizador mais alto está envolvido. No fim, a evolução é somente o resultado de um conjunto de
mutações que sobrevivem ou morrem. Certo?
- Certo - disse Arby.
- Porém, essa idéia apresenta problemas - prosseguiu Malcolm. - O primeiro é um problema de tempo. Uma única bactéria - a mais antiga forma de vida - tem
duas mil enzimas. Os cientistas fizeram a estimativa do tempo necessário para a união aleatória dessas enzimas a fim de formar a sopa primordial. Essas estimativas
vão de quarenta a cem bilhões de anos, mas a Terra tem só quatro bilhões de anos. Desse modo, só o acaso parece um processo lento demais. Especialmente considerando
que as bactérias só apareceram quatrocentos milhões de anos depois do começo da Terra. A vida apareceu rapidamente - por isso alguns cientistas concluíram que a
vida na Terra é de origem extraterrestre. Na minha opinião, isso é fugir ao problema.
- Muito bem...
- O segundo problema é o da coordenação. Se acreditarmos na teoria atual, então toda a complexidade maravilhosa da vida não passa de acúmulo de eventos casuais
- um conjunto de acidentes genéticos unidos. Porém, quando se estudam de perto os animais, vemos que vários elementos parecem ter evoluído simultaneamente. Os morcegos,
por exemplo, que possuem um sentido de ecolocalização, orientam-se pelo som. Para chegar a isso, várias coisas precisam evoluir. Os morcegos devem ter um aparelho
especializado para produzir sons, devem ter ouvidos para ouvir ecos, devem ter cérebros especializados para interpretar os sons e corpos especializados para mergulhar
no ar e caçar insetos. Se todas essas coisas não evoluírem simultaneamente, não haverá nenhuma vantagem. E imaginar que tudo isso acontece simplesmente por acaso
é como pensar que um tornado pode atingir um depósito de ferro-velho e montar um avião 747 em perfeito estado de funcionamento. É difícil acreditar nisso.
- Muito bem - disse Thorne. - Eu concordo.
- Vamos ao problema seguinte. A evolução nem sempre age como uma força cega. Certos nichos do meio ambiente não são preenchidos. Certas plantas não são usadas
como alimento. E certos animais não evoluem muito. Os tubarões não mudam há cento e sessenta milhões de anos. Os marsupiais não mudaram desde a extinção dos dinossauros,
há sessenta e cinco milhões de anos. Os ambientes dos animais mudaram espetacularmente, mas os animais permanecem quase os mesmos. Não exatamente os mesmos, mas
quase. Em outras palavras, é como se não tivessem respondido ao meio ambiente.
- Talvez já estivessem bem-adaptados - disse Arby.
- Pode ser, ou talvez seja alguma coisa que não sabemos.
- O quê, por exemplo?
- Certas regras que influenciam no resultado.
- Está dizendo que a evolução é dirigida? - perguntou Thorne.
- Não. Isso é criacionismo e é errado. Simplesmente errado. Estou dizendo que a ação da seleção natural sobre os genes talvez não seja toda a história. E
simples demais. Outras forças estão também em funcionamento. A molécula de hemoglobina é uma proteína dobrada como um sanduíche em volta de um átomo central de ferro
que aglutina o oxigênio. A hemoglobina se expande e se contrai quando recebe e fornece oxigênio - como um minúsculo pulmão molecular. Ora, conhecemos a seqüência
de aminoácidos que formam a hemoglobina. Mas não sabemos como dobrá-la. Felizmente não precisamos saber porque, se fizermos uma molécula, ela se dobra sozinha. Ela
se organiza. E essa parece ser uma das muitas provas de que todas as coisas vivas têm a propriedade de auto-organização. As proteínas se dobram. As enzimas interagem.
As células se dispõem para formar os órgãos, os órgãos se dispõem para formar um indivíduo coerente. E as populações se organizam para formar uma biosfera coerente.
Partindo da teoria da complexidade, começamos a perceber como pode acontecer essa auto-organização e o seu significado. E ela sugere uma mudança importante no modo
como vemos a evolução.
- Mas - disse Arby -, no fim, a evolução pode continuar a ser o resultado da ação do meio ambiente sobre os genes.
- Não acho que seja suficiente, Arb - disse Malcolm. - Acho que há mais coisas envolvidas. - Acho que tem de haver mais, até para explicar como surgiu a nossa
espécie.

- Há cerca de três milhões de anos - continuou Malcolm -, alguns macacos africanos que viviam nas árvores desceram para o chão. Não havia nada de especial
nesses macacos. Seus cérebros eram pequenos, e eles não eram especialmente inteligentes. Não tinham garras nem dentes afiados como armas. Não eram especialmente
fortes ou rápidos. Certamente não estavam preparados para enfrentar um leopardo. Mas, como eram pequenos, começaram a andar de pé para poder ver acima da alta relva
africana. Foi assim que começou. Apenas macacos comuns, olhando por cima da relva.
- Com o passar do tempo, os macacos passaram a ficar de pé durante mais tempo. Isso deixava suas mãos livres para fazer qualquer coisa. Como todos os macacos,
eles usavam ferramentas.
Os chimpanzés, por exemplo, usam gravetos para tirar cupins da terra. Esse tipo de coisa. Então, nossos ancestrais, os macacos, desenvolveram
ferramentas mais complexas. Isso estimulou o crescimento dos seus cérebros em tamanho e complexidade. Começou uma espiral. Ferramentas mais complexas levavam a um
cérebro mais complexo, que levava a ferramentas mais complexas.
E nossos cérebros literalmente explodiram, em termos de evolução. Nossos cérebros dobraram de tamanho num período de mais ou menos um milhão de
anos. E isso nos causou problemas. - Que problemas?
- Para começar, o problema de nascer. Cérebros grandes não podem passar pelo canal vaginal, o que significa que a mãe e o filho morreriam de parto. Isso
não é bom. Qual foi a resposta evolutiva? Fazer com que os bebês humanos nascessem numa fase anterior do desenvolvimento, quando
seus cérebros ainda podem passar pela pélvis. E a solução marsupial - a maior parte do crescimento ocorre fora do ventre materno. O cérebro
de uma criança humana dobra de tamanho no seu primeiro ano de vida. É uma boa solução para o problema do nascimento, mas cria outros problemas.
Significa que as crianças humanas são dependentes e indefesas durante muito tempo após o nascimento. Os filhotes da maioria dos mamíferos andam alguns minutos depois
de nascer. Outros dentro de alguns dias ou semanas. Mas os humanos só andam depois de um ano. Não podem se alimentar sozinhos durante mais
tempo ainda. Assim, um dos preços do cérebro maior foi que nossos antepassados tiveram de desenvolver uma organização social nova
e estável que permitisse cuidar das crianças durante muitos anos.
Essas crianças com cérebros grandes, completamente indefesas, mudaram a sociedade. Mas essa não é a conseqüência mais importante.
- Não?
- Não. Nascer num estado de imaturidade significa que os bebês humanos não têm os cérebros completamente formados. Eles não nascem com um comportamento instintivo
inerente. O máximo que podem fazer instintivamente é sugar e agarrar as coisas. O comportamento humano complexo não é instintivo. Assim, as sociedades humanas tiveram
de criar a educação para preparar os cérebros dos filhos, para ensiná-los a agir. Toda sociedade humana despende um grande tempo e grande quantidade de energia para
ensinar às crianças o comportamento adequado. Se olharmos para uma sociedade mais simples, em algum lugar da floresta tropical, veremos que cada criança nasce numa
rede de adultos responsáveis por sua educação. Não apenas os pais, mas tias e tios, avós e os anciãos da tribo. Uns ensinam a criança a caçar, apanhar alimento ou
tecer, outros ensinam tudo sobre sexo ou guerra. Mas as responsabilidades são claramente definidas, e, se uma criança não tiver, digamos, uma irmã do irmão da mãe
para uma instrução específica, o povo se reúne para apontar um substituto. Isso porque, em certo sentido, criar as crianças é a razão pela qual a sociedade existe.
E a coisa mais importante que acontece e a culminação de todos os instrumentos, linguagem e estrutura social criados pela sociedade. E finalmente, milhões de anos
depois, temos crianças usando computadores.
- Muito bem, se esse quadro tem sentido, onde atua a seleção fnatural? Atua no corpo, aumentando o cérebro? Atua na seqüência do desenvolvimento, fazendo
as crianças nascerem mais cedo? Age sobre o comportamento social, criando a cooperação no cuidado da criança? Ou age em toda a parte ao mesmo tempo - nossos corpos,
nosso desenvolvimento e nosso comportamento social?
- Em toda a parte ao mesmo tempo - disse Arby.
- E o que eu penso - concordou Malcolm. - Mas deve haver também partes dessa história que acontecem automaticamente, como resultado da auto-organizaçáo. Por
exemplo, os bebês de todas as espécies têm uma aparência característica. Olhos grandes, rosto pequeno, movimentos não-coordenados. Isso se aplica aos bebês humanos,
aos filhotes de cães e de aves. E parece provocar nos adultos um sentimento de ternura para com eles. De certo modo, podemos dizer que a aparência de um bebê auto-organiza
o comportamento do adulto. E no nosso caso isso é muito bom.
- O que isso tem a ver com a extinção dos dinossauros? - perguntou Thorne.
- Os princípios da auto-organização podem agir para melhorar ou piorar. Assim como a auto-organização pode coordenar a mudança, pode também levar uma população
ao declínio e fazer com que ela perca a força. Nesta ilha, tenho esperança de ver adaptações auto-organizadas no comportamento de verdadeiros , dinossauros - e isso
nos dirá por que foram extintos. Na verdade, tenho certeza de que já sei por que os dinossauros foram extintos.|
Ouviram a voz de Levine no rádio.
- Bravo. Eu mesmo não diria melhor. Mas talvez fosse bom você ver o que está acontecendo aqui. Os parassauros estão fazendo uma coisa muito interessante,
Ian.
- Que coisa?
- Venha ver.
- Meninos - disse Malcolm -, vocês ficam aqui cuidando dos monitores. -Apertou o botão transmissor do rádio. - Richard? Estamos indo.


OS PARASSAUROS


Richard Levine, tenso, segurou com força o parapeito do alto do abrigo, observando os animais. Bem à sua frente, a cabeça magnífica de um parassauro apareceu
sobre uma pequena elevação. A cabeça em forma de bico-de-pato do hadrossauro tinha um metro de comprimento mas parecia maior por causa da crista óssea inclinada
para trás.
Quando o animal chegou mais perto, Levine viu o mosqueado verde na cabeça. Viu o pescoço longo e poderoso, o corpo pesado com a barriga verde-clara. O parassauro
tinha três metros de altura e o tamanho aproximado de um elefante. A cabeça era quase da altura do assoalho do abrigo onde ele estava. O animal se movia determinadamente
para ele, os pés batendo com força no chão. Um pouco depois uma segunda cabeça apareceu - uma terceira e uma quarta. Os animais, soltando seu barrido, caminhavam
em fila indiana na direção dele.
Num instante o primeiro animal estava na frente do abrigo. Levine conteve a respiração. O parassauro girou o olho grande e marrom e olhou para ele. Lambeu
os lábios com a língua roxa. A pequena casa no alto estremeceu. Então, ele passou, dirigindo-se para a selva. Logo depois passou o segundo animal.
O terceiro raspou na pequena estrutura, balançando-a de leve. Mas o dinossauro aparentemente não notou e continuou seu caminho, seguido pelos outros. A terra
parou de vibrar. Foi então que ele viu a trilha dos animais que passava pela frente do abrigo e entrava na selva.
Levine suspirou.
Relaxou o corpo aliviado. Apanhou o binóculo e respirou fundo para se acalmar. O pânico desapareceu e ele começou a se sentir melhor.
Então pensou, o que eles estão fazendo? Para onde estão indo? Porque na sua opinião aquele comportamento dos parassauros era muito estranho. Eles formavam
um grupo defensivo enquanto comiam, mas de repente entraram em fila indiana, quebrando o padrão normal do bando e tornando cada animal vulnerável aos predadores.
Mas era um comportamento evidentemente organizado. Andar em fila indiana devia ter um objetivo específico.
Mas qual?
Agora que estavam no interior da selva, os animais começaram a dar os barridos de curta duração. Mais uma vez Levine achou que devia ser uma forma de vocalização
para informar sua posição. Talvez para que cada um soubesse onde estavam os outros enquanto se moviam na selva, sempre que mudavam de local.
Mas por que estavam mudando?
Para onde estavam indo? O que estavam fazendo?
Certamente nunca ia saber se ficasse ali no abrigo. Hesitou, ouvindo os barridos. Então, decidido, passou a perna pela grade e desceu pelo andaime.

O CALOR


Ela estava toda molhada e com muito calor. Uma coisa áspera como lixa roçou seu rosto uma vez, duas vezes. Sarah Harding tossiu. Um líquido com cheiro estranho,
como cerveja africana fermentada, pingou no seu pescoço. Ouviu um silvo surdo. Então, a coisa áspera outra vez, começando no pescoço e subindo para o rosto.
Ela abriu os olhos devagar e olhou para o focinho de um cavalo. O olho grande e opaco do cavalo olhou para ela entre as pestanas macias. O cavalo estava lambendo
seu rosto. Era quase agradável, ela pensou, quase tranqüilizador. Deitada na lama com um cavalo...
Não era um cavalo.
A cabeça era muito estreita, o focinho muito pontudo, todas as proporções erradas. Virou para o lado e viu uma cabeça pequena num pescoço extremamente grosso
e num corpo pesado...
De um salto ela ficou de joelhos.
- Oh, meu Deus!
Assustado com o movimento brusco, o animal bufou e recuou lentamente. Deu alguns passos na lama e olhou para trás, com uma expressão de censura.
Agora ela podia ver bem. Cabeça pequena, pescoço grosso, corpo enorme e desajeitado com uma fileira dupla de placas pentagonais verticais no alto das costas.
A cauda com farpas agudas arrastando no chão.
Harding piscou os olhos.
Não podia ser.
Confusa e atordoada, tentou lembrar o nome daquela criatura, e ele chegou, vindo da sua infância.
Estegossauro.
Era um maldito estegossauro.
Atônita, ela lembrou do quarto branco do hospital onde tinha visitado Malcolm, que, delirando, murmurava os nomes de várias espécies de dinossauros. Sarah
sempre suspeitou daquele delírio, mas mesmo agora, na frente de um estegossauro vivo, sua reação imediata foi de que devia ser alguma brincadeira, um truque. Olhou
atentamente para o animal, procurando descobrir a costura no tecido da fantasia, as juntas mecânicas sob a pele. Mas não viu nenhuma costura e os movimentos do animal
eram perfeitamente integrados e orgânicos. Os olhos piscaram lentamente. Então o estegossauro deu as costas para ela, foi até a margem do rio e começou a beber com
a língua grande e áspera.
A língua era azul-escura.
Como podia ser? Azul-escura de sangue venoso? Seria um animal de sangue frio? Não. Ele se movia muito à vontade, tinha a segurança - e a indiferença - das
criaturas de sangue quente. Lagartos e répteis sempre pareciam estar prestando atenção à temperatura do ambiente. Mas essa criatura não se comportava desse modo.
Estava parada na sombra, bebendo a água fria, indiferente a tudo.
Sarah olhou para sua camisa e viu o líquido espumoso escorrendo do seu pescoço. Era baba de estegossauro. Tocou o líquido com a ponta do dedo. Era quente.
Sim, era um animal de sangue quente.
Um estegossauro.
Ela olhou, perplexa.
A pele do estegossauro parecia de pedra, mas não era escamosa como a de um réptil. Parecia mais a pele de um rinoceronte, pensou ela. Ou de um javali africano.
Com a diferença de que não tinha os pêlos nem as cerdas do javali.
O estegossauro se movia lentamente. Tinha um expressão pacata, estúpida. E provavelmente era estúpido, pensou Sarah, olhando outra vez para a cabeça do animal.
O crânio era menor que o de um cavalo. Pequeno demais para o peso do corpo.

Sarah levantou-se e gemeu. Estava com todo o corpo dolorido. Suas pernas tremiam. Ela respirou fundo.
Poucos metros adiante, o estegossauro parou de beber e olhou para ela, examinando sua nova aparência agora que estava de pé. Ela não se moveu e o animal voltou
a beber, indiferente.
- Grande droga - ela disse, em voz alta.
Olhou para o relógio. Uma hora da tarde e o sol ainda alto. Não podia se orientar pelo sol e a tarde estava muito quente. Resolveu que o melhor seria começar
a andar e procurar Malcolm e Thorne. Descalça, com todos os músculos doloridos, ela começou a andar na selva, afastando-se do rio.
Depois de caminhar por meia hora sentiu sede, mas estava acostumada a passar longos períodos sem água na savana africana. Continuou, indiferente ao desconforto.
Próximo ao topo da cordilheira ela encontrou uma trilha de animais, larga e lamacenta que entrava na selva. Era mais fácil andar na trilha e ela a seguia a uns quinze
minutos quando ouviu um grito nervoso vindo de algum lugar à frente. Pareciam cães, e ela continuou cautelosamente.
Ouviu então o som de alguma coisa chocando-se no meio do mato alto e vindo de várias direções ao mesmo tempo, e de repente um animal que parecia um lagarto
verde-escuro, com mais ou menos um metro e vinte de altura, saiu do meio da folhagem numa velocidade incrível, soltou um grito agudo e saltou por cima dela. Sarah
abaixou a cabeça instintivamente e mal teve tempo de se refazer do susto quando um segundo animal apareceu e passou correndo por ela. Em poucos instantes, um bando
de animais estava passando por todos os lados, correndo enlouquecidamente e gritando de medo, e então um deles roçou nela e a derrubou. Sarah caiu na lama, e os
outros animais continuaram a passar, saltando por cima dela.
Um pouco adiante na trilha, ela viu uma árvore grande com galhos baixos. Sem pensar, ela levantou de um salto, segurou o galho e subiu na árvore. Nesse instante
um novo dinossauro com garras afiadas nos pés atravessou correndo a trilha de lama abaixo dela, e tomou o mesmo caminho das criaturas verdes. Quando esse animal
se afastou, ela viu seu corpo enorme e escuro, com três metros de altura e listras avermelhadas como as de um tigre. Logo apareceu outro animal listrado, depois
um terceiro - um bando de predadores, bufando e rosnando, perseguindo os dinossauros verdes.
Instintivamente, levada por sua experiência de pesquisa de campo, ela começou a contar os animais que passavam lá embaixo. Contou nove predadores listrados
e isso imediatamente despertou seu interesse. Não fazia sentido, pensou. Assim que passou o último predador, ela desceu da árvore e apressadamente foi atrás deles.
Por um momento pensou que fosse tolice, mas a curiosidade venceu.
Sarah subiu a colina atrás dos dinossauros-tigres, mas, antes de chegar ao topo teve certeza, pelos rugidos e rosnados, que já tinham abatido a presa. No
topo ela olhou para o local da caça.
Mas era diferente de tudo o que já havia visto na África. Na planície de Seronera, o local da caça tem uma organização própria, bastante previsível e de certo
modo até imponente. Os maiores predadores, leões ou hienas, ficavam perto da carcaça, alimentando-se ao lado dos seus filhotes. Mais distante, esperando sua vez,
ficavam os abutres e as cegonhas marabus, e, mais distante ainda, os chacais e outros animais necrófagos andavam em círculo, esperando. Quando os grandes predadores
terminavam, os animais menores tomavam seu lugar. Animais diferentes comiam partes diferentes do corpo. As hienas e os abutres comiam os ossos, os chacais retiravam
toda a carne que restava na carcaça. Esse era o padrão de qualquer tipo de caça, e, como resultado, havia pouca briga ou disputa em volta do alimento.
Mas o que ela estava vendo era um pandemônio - uma avidez frenética. A presa derrubada estava coberta pelos grandes predadores listrados, todos arrancando
furiosamente a carne da carcaça, com pausas freqüentes para rosnar e rugir uns para os outros. As lutas eram de uma crueldade incrível - um predador mordeu o flanco
de outro predador, causando um ferimento grande e profundo. Imediatamente, vários outros predadores rosnaram para o animal gravemente ferido, que se afastou mancando,
rosnando e sangrando. Ao chegar à periferia do grupo, ele retaliou, mordendo outra criatura, causando também um ferimento profundo.
Um predador jovem, com a metade do tamanho dos outros, empurrava, tentando abrir caminho até a carcaça, mas os adultos não permitiam, rosnando furiosos para
ele. O pequeno predador muitas vezes tinha de saltar para trás para se livrar dos dentes afiados dos adultos. Harding não viu nenhum filhote. Aquela era uma sociedade
de adultos cruéis.
Olhando para as cabeças e os corpos dos grandes predadores sujos de sangue, ela notou as cicatrizes entrecruzadas nos flancos e pescoços. Aqueles eram obviamente
animais ágeis e inteligentes, mas estavam sempre brigando. Sua organização social teria evoluído assim? Se fosse, era um caso muito raro.
Animais de várias espécies lutam pelo alimento, pelo território e por sexo, mas essas lutas quase sempre envolvem uma demonstração ritual de agressividade.
Ferimentos graves raramente ocorrem. É claro que há exceções. Quando os hipopótamos machos disputam um harém, quase sempre ferem gravemente outros machos. Mas mesmo
assim, nada se comparava com o que estava vendo.
O jovem animal, na periferia do grupo, avançou e mordeu outro adulto, que rosnou e saltou para ele, atacando-o com as garras longas dos pés. Num instante
o jovem predador foi eviscerado, e seu intestino saltou para fora pela enorme abertura. O animal caiu e imediatamente os adultos se afastaram da presa que devoravam,
caíram sobre o corpo dele e começaram a arrancar a carne com frenética intensidade.
Harding fechou os olhos e se afastou. Aquele era um mundo diferente, um mundo que ela não queria compreender. Atordoada, desceu a colina, movendo-se silenciosa
e cautelosamente para longe da cena de caça.

O RUÍDO


O Ford Explorer seguia silenciosamente pela trilha da selvak Estavam seguindo a trilha no alto da cordilheira acima do vale, à caminho do posto de observação,
lá embaixo. ,
Thorne estava dirigindo. Ele disse para Malcolm:
- Há pouco você disse que sabia por que os dinossauros foram extintos...
- Bem, tenho quase certeza de que sei. A situação básica é bastante simples. - Mudou de posição no banco. - Os dinossauros surgiram no Triássico, cerca de
duzentos e vinte e oito milhões de anos atrás. Proliferaram nos dois períodos seguintes, o Jurássico e o Cretáceo. Foram a forma de vida dominante neste planeta
durante cerca de cento e cinqüenta milhões de anos - o que é um longo tempo.
- Considerando que estamos aqui apenas há três milhões - disse Eddie.
- Não vamos contar vantagem - disse Malcolm. - Alguns macacos insignificantes estão neste planeta há três milhões de anos. Nós não. Os seres humanos reconhecíveis
estão neste planeta há apenas trinta e cinco mil anos. Época que nossos ancestrais pintaram nas cavernas da França e da Espanha, desenhando os animais, na crença
de que isso atrairia sorte para a caçada. Trinta e cinco mil anos. Na história da Terra isso não é nada. Acabamos de chegar.
- Tudo bem...
- E é claro que mesmo há trinta e cinco mil anos já estávamos provocando a extinção das espécies. O homem das cavernas matou tanto que vários animais foram
extintos em vários continentes.
Havia leões e tigres na Europa. Havia girafas e rinocerontes em Los Angeles. Que diabo, há dez mil anos, os ancestrais dos americanos nativos caçaram o mamute
até provocar a extinção desse animal. Isso não é novidade, essa tendência dos humanos para...
- Ian.
- Bem, é um fato, embora alguns cabeças-ocas modernos pensem que tudo é tão novo que...
- Ian. Você estava falando de dinossauros.
- Certo. Dinossauros. Bem, durante cento e cinqüenta milhões de anos neste planeta os dinossauros foram tão bem-sucedidos que no Cretáceo havia vinte e um
grupos principais deles. Alguns grupos, como os camarassauros e fabrossauros, já tinham desaparecido. Mas a grande maioria dos grupos de dinossauros estava ainda
em atividade no Cretáceo. Então, de repente, há cerca de sessenta e cinco milhões de anos, todos os grupos foram extintos. Só ficaram os pássaros. Assim, a questão
é... O que foi isso?
- Pensei que você já soubesse - disse Thorne.
- Não. Estou falando desse som. Não ouviu nada?
- Não.
- Pare o carro - disse Malcolm.
Thorne parou o carro e desligou o motor. Abaixaram os vidros e sentiram o calor e o ar parado do meio-dia. Quase não havia brisa. Escutaram por um tempo.
Thorne deu de ombros.
- Não ouço nada. O que você acha que...
- Ssh - disse Malcolm. Pôs a mão em concha atrás da orelha e a cabeça para fora, escutando 'atentamente. Depois de um momento disse: - Era capaz de jurar
que ouvi um motor.
- Um motor? Quer dizer um motor de combustão interna?
- Isso mesmo. - Apontou para o leste. - Parecia vir dali. Prestaram atenção, mas não ouviram nada.
Thorne balançou a cabeça.
- Não posso imaginar um motor a gasolina aqui, Ian. Não existe gasolina na ilha.
Arby disse no rádio:
- Dr. Malcolm?
- Sim, Arby.

- Quem mais está aqui? Na ilha?
- O que quer dizer?
- Ligue seu monitor.
Thorne ligou o monitor no painel. A tela mostrou a vista de uma das câmeras de segurança, uma parte do vale íngreme do leste. Viram a encosta de uma colina,
escura sob as árvores. Um galho bloqueava parte da cena. Mas tudo estava parado, silencioso, nenhum sinal de atividade.
- O que você viu, Arby?
- Fiquem olhando. Através das folhas, Thorne viu alguma coisa se movendo. Era uma pessoa
com roupa caqui, meio andando, meio escorregando, descendo a encosta na direção do vale. Vulto pequeno e compacto, cabelo escuro e curto.
- Minha nossa - disse Malcolm comum sorriso.
- Sabe quem é?
- Sim, claro. E Sarah.
- Bem, acho melhor irmos apanhá-la. - Thorne apanhou o rádio e pressionou o botão. - Richard - ele disse. Nenhuma resposta.
- Richard? Está me ouvindo? Nada.
Malcolm suspirou.
- Isso é ótimo. Ele não responde. Provavelmente resolveu dar um passeio. Continuando sua pesquisa...
- É disso que eu tenho medo - disse Thorne. - Eddie, apanhe a moto e vá ver o que Levine está fazendo. Leve um Lindstradt com você. Nós vamos apanhar Sarah.


A TRILHA


Levine seguiu a trilha, embrenhando-se cada vez mais na floresta escura. Os parassauros estavam em algum lugar à sua frente. Ele ouvia o ruído dos corpos
passando entre as folhagens e dos passos pesados no chão coberto de folhas. Pelo menos agora ele compreendia o porquê da fila indiana. De outro modo não poderiam
passar pela densa floresta tropical.
Os urros não paravam, mas Levine notou que começavam a ficar diferentes - mais agudos, mais nervosos. Apressou o passo, abrindo caminho entre as enormes palmeiras,
mais altas do que ele, acompanhando a trilha dos animais. Começou a sentir um cheiro estranho, picante e agridoce. Tinha a impressão de que o cheiro ficava cada
vez mais forte.
Mas lá na frente alguma coisa estava acontecendo. A vocalização dos parassauros era agora entrecortada, quase como latidos. Pareciam agitados. Mas o que podia
agitar um animal de três metros de altura e dez metros de comprimento?
Dominado pela curiosidade, Levine começou a correr na selva, empurrando as folhas para os lados, saltando sobre árvores caídas. Ouvia sons agudos como silvos,
o som de água caindo sobre alguma coisa e então um dos parassauros soltou um urro grave longo e alto.
Eddie Carr chegou com a moto ao posto de observação. Levine não estava. Examinou o solo em volta e viu várias marcas de patas de animais. Eram grandes, de
cerca de sessenta centímetros de diâmetro, e pareciam seguir na direção da selva, atrás do abrigo.
Eddie viu também marcas de botas Asolo, as que Levine usava. Em alguns lugares, as marcas das botas sobrepunham-se às dos animais, o que significava que haviam
sido feitas depois. As pegadas de Levine também levavam à floresta.
Eddie Carr praguejou. A última coisa que queria era entrar na selva. Só de pensar ficava arrepiado. Mas não tinha escolha. Tinha de trazer Levine de volta.
Aquele cara, pensou, ia ser um problema. Eddie tirou o rifle do ombro e o pôs sobre o guidom da moto. Depois ligou o motor e a moto seguiu silenciosamente para a
selva escura.
Com o coração disparado, na expectativa do que poderia descobrir, Levine abriu a folhagem na sua frente e parou. A cauda de um parassauro balançava acima
da sua cabeça. O animal estava de costas para ele. E um jato espesso de urina jorrava do traseiro do parassauro para o chão. Levine saltou para trás, para não ser
atingido. Além do enorme animal, ele via vários parassauros com os pés firmados no chão de terra batida. Estavam todos dentro da clareira, urinando ao mesmo tempo.
Então os parassauros eram animais com lugar certo para fazer suas necessidades, uma coisa fascinante e inesperada.
Vários animais do nosso tempo, incluindo rinocerontes e gamos, fazem isso em locais determinados. Muitas vezes é uma ação coordenada de todo o bando. E um
comportamento geralmente considerado como um modo de marcar o território. Mas, fosse por que fosse, ninguém jamais havia imaginado que os dinossauros também faziam
isso.
Os parassauros terminaram de urinar, e cada um deu um passo para o lado. Então, defecaram em uníssono, cada um produzindo uma grande quantidade de fezes cor-de-palha.
O ato foi acompanhado por roncos surdos e uma quantidade enorme de gases com cheiro de metano.
Atrás dele, uma voz murmurou:
- Uma beleza.
Levine se voltou e viu Eddie, montado na motocicleta, balançando a mão na frente do rosto.
- Peidos de dinossauro - ele disse. - Acho melhor não acender um fósforo por aqui, senão vamos pelos ares...
- Sshh - fez Levine, zangado, balançando a cabeça. Não era hora de ser interrompido por um tolo vulgar. Alguns animais inclinaram as cabeças e começaram a
lamber as poças de urina. Sem dúvida para recuperar os nutrientes, pensou Levine. Sal, talvez. Ou hormônios. Ou quem sabe fosse algo que faziam em certos períodos.
Ou ainda...
Levine deu um passo à frente.
Sabiam tão pouco sobre aquelas criaturas! Não conheciam nem os fatos básicos de suas vidas - como comiam, como eliminavam, como dormiam e se reproduziam.
Um mundo de comportamentos complexos e interligados havia evoluído naqueles animais há tanto tempo extintos. Compreendê-los podia ser o trabalho de uma vida. Mas
talvez jamais acontecesse. Tudo o que ele podia esperar eram algumas conjeturas, algumas deduções simples que não ultrapassariam a superfície da complexidade da
vida dos dinossauros.
Os parassauros soltaram seu grito estridente, que lembrava o barrido de um elefante, e caminharam para o interior da floresta. Levine avançou, pronto para
segui-los.
- Dr. Levine - Eddie disse, em voz baixa. - Suba na moto. Agora.
Levine o ignorou, mas assim que os grandes animais partiram, viu dezenas de pequenos dinossauros verdes saltarem para a clareira. Reconheceu imediatamente
os Procompsognathus triassicus. Pequenos necrófagos encontrados por Fraas na Bavária, em 1913. Levine olhou fascinado. Conhecia bem aqueles animais, mas só por reconstruções,
porque não existiam esqueletos completos dos Procompsognathus em lugar nenhum do mundo. Ostrom havia feito o estudo mais completo, mas teve de trabalhar com um esqueleto
muito amassado e fragmentado, sem a cauda, o pescoço e os braços. Porém, ali estavam os Procompsognathus, completos e ativos, saltando na clareira como um bando
de galinhas. Os comps começaram a comer as fezes frescas e a beber o que restava da urina. Levine perguntou-se se aquilo fazia parte do comportamento comum dos necrófagos.
Não tinha certeza...
Avançou mais um pouco para ver melhor.
- Dr. Levine - murmurou Eddie.
Levine notou que os comps comiam só as fezes frescas, não os restos de fezes secas que enchiam a clareira. Fossem quais fossem os nutrientes que eles obtinham,
só deviam existir nas fezes frescas. Isso sugeria uma proteína ou hormônio que se degrada com o tempo. Talvez fosse bom obter uma amostra das fezes para análise.
Tirou do bolso um pequeno saco de plástico e entrou na clareira, no meio dos comps, que ignoraram sua presença.
Levine abaixou ao lado da pilha mais próxima e estendeu o braço vagarosamente.
- Dr. Levine!
Olhou para trás, zangado, e naquele momento um dos comps saltou para a frente e mordeu a mão dele. Outro pulou para seu ombro e mordeu a orelha. Levine gritou
e levantou. Os comps saltaram para o chão e fugiram.
- Droga! - ele exclamou. Eddie avançou com a moto.
- Agora chega - ele disse. - Suba na maldita moto. Vamos dar o fora daqui.

O NINHO


O jipe Wrangler vermelho parou. Logo à frente, a trilha que estavam seguindo continuava no meio da folhagem, levando a uma clareira um pouco além. A trilha
era larga e cheia de lama, com marcas dos pés dos grandes animais.
Vindo da clareira, ouviram um ruído como o grasnar de gansos grandes. Dodgson disse:
- Tudo bem. Dê-me a caixa. King não respondeu.
- Que caixa? - perguntou Baselton.
Sem tirar os olhos da clareira, Dodgson disse:
- Há uma caixa preta no banco atrás de você e um conjunto de baterias. Me alcance os dois.
- São pesados - resmungou Baselton.
- Sim, por causa dos magnetos cônicos. - Dodgson estendeu o braço para trás e apanhou a caixa feita de metal negro anodizado. Tinha o tamanho de uma caixa
de sapatos, mas terminava num cone aberto. Sob a caixa estava encaixado um cano de pistola. Dodgson prendeu a bateria no cinto e segurou a caixa pelo cabo de pistola.
Havia um botão na parte de trás e um painel graduado.
- As baterias estão carregadas? - Dodgson perguntou.
- Estão carregadas - disse King.
- Tudo bem. Eu entro primeiro na área do ninho. Ajusto a caixa e afugento os animais. Vocês dois vêm atrás, e, assim que os animais se afastarem, cada um
pega um ovo do ninho. Depois, saem da clareira. Entenderam?
- Certo - disse Baselton.
- OK - disse King. - Que dinossauros são esses?
- Não tenho a menor idéia - disse Dodgson, descendo do carro. - E não faz a menor diferença. Apenas sigam o procedimento. - Fechou a porta silenciosamente.
Os outros desceram do jipe e seguiram atrás dele na trilha, enfiando os pés na lama. Os sons na clareira continuavam. Dodgson tinha a impressão de que havia
muitos animais.
Ele afastou as últimas folhas de samambaia e os viu.
O ninho estava num local bem amplo com quatro ou cinco montes baixos de terra cobertos de relva. Cada monte tinha cerca de dois metros de largura e um metro
de profundidade. Vinte adultos de cor bege estavam em volta dos ninhos - um bando completo de dinossauros. E eram todos grandes, de dez metros de comprimento e três
metros de altura, todos rosnando e grasnando.
- Oh, meu Deus - disse Baselton, atônito. Dodgson balançou a cabeça.
- São maiassauros - ele murmurou. - Isto vai ser mole.

O nome maiassauro foi dado pelo paleontólogo Jack Horner. Antes de Horner, os cientistas pensavam que os dinossauros abandonassem os ovos, como a maioria
dos répteis. Essa idéia combinava com a descrição antiga dos dinossauros como répteis de sangue frio. Como os répteis, eles aprendiam a ser solitários. Os murais
pintados nos museus raramente mostravam mais de um exemplo de cada espécie - um brontossauro aqui, um estegossauro ali ou um tricerátops mais adiante, andando nos
pântanos. Mas as escavações feitas por Horner nos pântanos de Montana forneceram provas claras e definitivas de que pelo menos uma espécie de hadrossauro construía
ninhos e cuidava da cria. Horner incorporou esse comportamento ao nome que deu a essas criaturas. Maiassauro significa "lagarto boa mãe".
Observando-os agora, Dodgson podia ver que os maiassauros eram de fato pais atenciosos. Os adultos grandes, andando em volta dos ninhos, moviam-se cautelosamente
para não pisar nas elevações rasas dentro das quais estavam os filhotes e os ovos. Os maiassauros eram dinossauros de cor bege e cabeças grandes que terminavam num
focinho largo e achatado como o bico do pato.
Estavam apanhando molhos de relva com os dentes para depositar nos ninhos. Dodgson sabia que a finalidade da relva era regular a temperatura dos ovos. Se
o animal enorme sentasse sobre os ovos, iria quebrá-los. Assim, eles usavam a relva para conservar o calor e manter a temperatura constante. Os animais trabalhavam
continuamente.
- Eles são enormes - disse Baselton.
- Não passam de vacas muito grandes - observou Dodgson. A despeito do seu tamanho, os maiassauros eram herbívoros e pareciam realmente vacas dóceis e estúpidas.
- Prontos? Lá vamos nós.
Ele ergueu a caixa como se fosse um arma e entrou na clareira.

Dodgson esperava uma forte reação dos maiassauros quando o vissem, mas não houve nenhuma. Eles quase não o notaram. Um dos adultos levantou a cabeça, olhou
para ele com uma expressão estúpida e virou para o outro lado. Os animais continuaram a cobrir de relva os ovos, que eram brancos, esféricos e tinham quase sessenta
centímetros de comprimento, mais ou menos duas vezes maiores do que um ovo de avestruz. Do tamanho de uma bola de praia. Não havia nenhum filhote ainda.
King e Baselton entraram na clareira e ficaram ao lado de Dodgson. Os maiassauros os ignoraram também.
- Espantoso - disse Baselton.
- Ótimo para nós - disse Dodgson, ligando a caixa.
Um som alto e estridente encheu o ar. Imediatamente os maiassauros se voltaram para onde Dodgson estava, grasnando e levantando a cabeça. Pareciam agitados,
confusos. Dodgson girou o botão e o som ficou mais alto, ensurdecedor.
Os maiassauros balançaram as cabeças e se afastaram do som, agrupando-se na outra extremidade da clareira. Vários deles urinaram de medo. Continuavam agitados,
mas não tentaram se aproximar.
- Vão agora - disse Dodgson.
King entrou no ninho mais próximo e gemeu quando apanhou o ovo. Seus braços mal davam para envolver a enorme esfera. Os maiassauros grasnaram para ele, mas
nenhum dos adultos avançou. Então Baselton entrou no ninho, apanhou um ovo e voltou com King para o carro.
Dodgson começou a andar de costas, erguendo a caixa na direção dos adultos. Na entrada da clareira, ele desligou o som.
Imediatamente os maiassauros voltaram, grasnando alto e repetidamente. Mas, quando chegaram perto dos ninhos, era como se tivessem esquecido tudo. Depois
de pouco tempo pararam de grasnar e voltaram ao trabalho de cobrir os ovos com relva. Ignoraram Dodgson quando ele saiu da clareira e voltou para o jipe.
Animais estúpidos, pensou Dodgson. Baselton e King estavam acondicionando os ovos em caixas grandes de isopor e protegendo-os com espuma, os dois sorrindo
satisfeitos como duas crianças.
- Foi espantoso!
- Formidável! Fantástico.
- O que eu disse? Sem problema - disse Dodgson, consultando o relógio. - Desse jeito acabaremos em menos de quatro horas.
Entrou no jipe e ligou o motor. Baselton sentou atrás. King, na frente, apanhou o mapa.
- O seguinte - disse Dodgson.

O POSTO DE OBSERVAÇÃO


- Eu já disse que não é nada - Levine disse, irritado, suando no ar quente e parado, sob o telhado de alumínio do abrigo. - Veja, nem abriu a pele. - Estendeu
a mão, mostrando o semicírculo vermelho onde o comp tinha mordido. Mas era só isso.
- Sim, tudo bem - disse Eddie. - Mas sua orelha está sangrando um pouco.
- Não sinto nada. Não pode ser grave.
- Não, não é grave. - Eddie abriu a caixa de primeiros-socorros. - Mas é melhor limpar um pouco.
- Prefiro continuar com a minha observação - disse Levine. Os dinossauros estavam a menos de quatrocentos metros e ele
os via muito bem. No ar parado ele ouvia a respiração dos animais. Ele ouvia a respiração dos animais. Ou ouviria se aquele jovem o deixasse em paz.
- Escute - Levine disse. - Eu sei o que estou fazendo aqui. Você chegou no fim de uma experiência muito interessante e muito bem-sucedida. Na verdade, eu
chamei os dinossauros imitando a voz deles.
- Chamou os dinossauros? - perguntou Eddie.
- Sim, chamei. Por isso eles foram para a floresta. Assim, acho que não preciso da sua ajuda...
- O caso - disse Eddie - é que você tem um pouco daquelas fezes de dinossauro na orelha e uns pequenos ferimentos. Vou limpar para você. - Molhou uma compressa
de gaze no desinfe-tante. - Pode arder um pouco.
- Não me importo, tenho outras... Ai!
- Fique quieto. Não vai demorar nada.
- E absolutamente desnecessário.
- Veja se fica quieto até eu terminar. Pronto. - Tirou a gaze. Levine viu alguma coisa marrom na gaze e umas linhas
vermelhas. Exatamente como pensava. Um ferimento sem importância. Levou a mão à orelha. Não sentiu dor.
Levine olhou para a planície, enquanto Eddie guardava a caixa de primeiros-socorros.
- Nossa, está quente aqui em cima - Eddie disse.
- Sim, está. - Levine deu de ombros.
- Sarah Harding chegou e acho que eles já a levaram para o trailer. Quer voltar agora?
- Não vejo por quê.
- Pensei que gostaria de dizer olá ou coisa assim - disse Eddie.
- Meu trabalho é aqui - disse Levine, levando o binóculo aos olhos.
- Então - disse Eddie - não quer voltar?
- Nem penso nisso. - Levine continuou a olhar com o binóculo. - Nem em um milhão de anos. Nem em sessenta e cinco milhões de anos.

O TRAILER


Kelly Curtis ouvia o som do chuveiro. Ela mal podia acreditar. Olhou para a roupa espalhada em cima da cama. Short e uma camisa caqui de manga curta.
A roupa de Sarah Harding.
Não dava para se controlar e ela estendeu a mão e tocou as peças de roupa. Notou que a fazenda estava gasta, os botões não combinavam e havia umas manchas
vermelhas perto do bolso que imaginou ser sangue.
- Kelly? - Sarah chamou, do chuveiro. Ela lembrou o meu nome.
- Sim? - A voz de Kelly traía seu nervosismo.
- Tem algum xampu?
- Vou ver, Dra. Harding. - Kelly começou a abrir as gavetas apressadamente. Os homens tinham ido para o outro compartimen-to, deixando-a só com Sarah. Kelly
procurou desesperadamente, abrindo e fechando gavetas.
- Escute... tudo bem se não encontrar - disse Sarah.
- Estou procurando...
- Será que tem algum detergente de lavar pratos? Kelly olhou em volta. Viu um frasco verde na pia.
- Tem, Dra. Harding, mas...
- Pode me dar. É tudo a mesma coisa. Eu não me importo. - A mão apareceu no lado de fora da cortina do chuveiro e Kelly entregou o frasco para ela. - E o
meu nome é Sarah.
- Está bem, Dra. Harding.
- Sarah.
- Está bem, Sarah.
Sarah Harding era uma pessoa como as outras. Muito informal e normal.
Encantada, Kelly sentou no banco da cozinha, balançando as pernas, esperando, para o caso de Dra. Harding - Sarah - precisar de mais alguma coisa. Ouviu Sarah
cantarolar "I'm Gonna Wash That Man Right Out of My Hair". Depois de alguns momentos, ela fechou o chuveiro, estendeu a mão para fora da cortina e saiu enrolada
na toalha.
Sarah passou os dedos no cabelo curto, aparentemente a única atenção que dispensava à própria aparência.
- Agora, sim. Nossa, este trailer é mesmo de luxo. Thorne fez um belo trabalho.
- Sim - disse Kelly. - É muito bom.
- Quantos anos você tem, Kelly? - Sarah perguntou, com um sorriso.
- Treze.
- Está em que série, oitava?
- Sétima.
- Sétima série - Sarah disse, pensativa.
- O Dr. Malcolm deixou alguma roupa para você. Disse que acha que vai servir. - Apontou para o short e a camiseta.
- De quem são?
- Acho que de Eddie.
Sarah examinou a roupa.
- Talvez sirvam. - Foi para onde ficavam as camasbe começou a se vestir. - O que vai ser quando crescer?
- Eu não sei - disse Kelly.
- Uma ótima resposta.
- É mesmo? - A mãe de Kelly estava sempre insistindo em que ela arrumasse um emprego de meio-expediente para resolver o que queria fazer na vida.
- E - disse Sarah. - Nenhuma pessoa inteligente sabe o que quer fazer antes dos vinte ou trinta anos.
- Ah!
- Quais as matérias de que você gosta?

- Na verdade, bem, gosto de matemática - ela disse em voz baixa e como quem pede desculpas.
Sarah percebeu o tom e disse:
- O que há de errado com matemática?
- Bem, as meninas não são boas em matemática, sabe como é.
- Não, eu não sei - Sarah disse, secamente.
Kelly entrou em pânico. Até aquele momento tinha a impressão de estar muito próxima de Sarah Harding, mas agora a sensação começava a se dissolver, como se
tivesse dado a resposta errada para uma professora severa. Resolveu não dizer mais nada e esperou em silêncio.
Sarah apareceu com a roupa de Eddie, demasiado grande para ela. Sentou e começou a calçar as botas. Movia-se naturalmente e parecia muito à vontade.
- O que quis dizer quando afirmou que as mulheres não são boas em matemática?
- Bem, é o que todos dizem.
- Todos quem?
- Meus professores.
Sarah suspirou.
- Ótimo - disse balançando a cabeça. - Seus professores...
- As outras meninas me chamam de crânio. Coisas assim - Kelly disse, quase instintivamente. Não acreditava que estivesse dizendo tudo aquilo para Sarah Harding,
que só conhecia por seus artigos e fotografias, mas lá estava ela falando de coisas muito pessoais que a perturbavam.
Sarah sorriu.
- Bem, se elas dizem isso, você deve ser muito boa em matemática, estou certa?
- Acho que sim.
- Isso é maravilhoso, Kelly. - Ela sorriu.
- Mas o caso é que os meninos não gostam de meninas muito inteligentes.
Sarah ergueu as sobrancelhas.
- Não mesmo?
- Bem, é o que todos dizem...
- Todos quem?
- Minha mãe, por exemplo.
- Hum, hum. E provavelmente ela sabe do que está falando.
- Eu não sei - admitiu Kelly. - Na verdade, minha mãe só sai com idiotas.
- Então ela pode estar errada. - Sarah estava amarrando os cordões da bota e ergueu os olhos para Kelly.
- Acho que sim.
- Bem, de acordo com a minha experiência, alguns homens gostam de mulheres inteligentes, outros não. É como tudo no mundo. - Ela ergueu a cabeça. - Já ouviu
falar em George Schaller?
- Claro. Ele estudou os pandas.
- Certo. Pandas, e antes disso, leopardos e gorilas. E o pesquisador de animais mais importante do século XX. Você sabe como ele trabalha?
Kelly balançou a cabeça.
- Antes de sair para a pesquisa de campo, George lê tudo o que já foi escrito sobre o animal que vai estudar. Livros populares, revistas especializadas, artigos
científicos, tudo. Então ele sai e observa o animal. E você sabe o que ele geralmente descobre?
Kelly balançou a cabeça, não confiando na própria voz.
- Que quase tudo o que foi escrito ou dito está errado. Como o caso dos gorilas. George estudou os gorilas das montanhas dez anos antes de Dian Fossey começar
a pensar nisso. E descobriu que tudo o que pensavam sobre os gorilas era exagero, ou mal-entendido, ou simplesmente fantasia - como a idéia de que mulheres não devem
fazer parte das expedições que estudam gorilas porque os animais as estupram. Errado. Tudo... completamente... errado.
Sarah terminou de amarrar as botas e levantou.
- Portanto, Kelly, mesmo com sua pouca idade, há uma coisa que deve aprender agora. Durante toda a sua vida as pessoas vão dizer uma porção de coisas. E na
maior parte das vezes, provavelmente em noventa e cinco por cento das vezes, tudo o que elas disserem estará errado.
Kelly continuou em silêncio, estranhamente desanimada.
- É um fato da vida - disse Sarah. - Os seres humanos estão recheados de desinformação. Assim, é difícil saber em quem acreditar. Eu sei o que você sente.
- Sabe?
- Claro. Minha mãe costumava dizer que eu nunca seria nada na vida. - Ela sorriu - Alguns dos meus professores diziam a mesma coisa.
- Verdade? Não parece possível.
- Mas é - disse Sarah. - Na verdade...
Ouviram Malcolm dizer, no outro compartimento do trailer:
- Não! Não! Aqueles idiotas! Podem estragar tudo! Sarah imediatamente foi ver do que se tratava. Kelly saltou do banco e foi atrás dela.

Os homens estavam na frente do monitor, todos falando ao mesmo tempo, e pareciam preocupados.
- Isto é terrível - disse Malcolm. - Terrível!
- Aquilo é um jipe ? - Thorne perguntou.
- Eles tinham um jipe vermelho - Sarah disse, aproximando-se e olhando para o monitor.
- Então é Dodgson - disse Malcolm. - Droga!
- O que ele está fazendo aqui?
- Posso adivinhar.
Kelly abriu caminho entre os adultos e olhou. Na tela, ela viu folhagem e imagens intermitentes de um veículo vermelho e preto.
- Onde eles estão agora? - Malcolm perguntou para Arby.
- Acho que estão no vale do leste, perto de onde encontramos o Dr. Levine.
Levine disse no rádio:
- Está dizendo que há outras pessoas na ilha?
- Sim, Richard.
- Bem, acho melhor tratar de detê-las antes que estraguem tudo.
- Eu sei. Quer voltar para o trailer?
- Não sem um motivo urgente. Mantenham-me informado - ele desligou o rádio.
Harding olhou para a tela, observando o jipe.
- Sim, são eles - ela disse. - Seu amigo Dodgson.
- Ele não é meu amigo - disse Malcolm, levantando e fazendo uma careta de dor. - Vamos. Precisamos deter aqueles filhos da mãe. Não temos tempo a perder.

O NINHO


O jipe Wrangler vermelho parou silenciosamente. Logo à frente havia um muro denso de folhagem. Mas através dele, podiam ver a luz do sol na clareira logo
adiante.
Dodgson ficou sentado no carro, escutando. King voltou-se para ele e ia falar, mas Dodgson ergueu a mão, pedindo silêncio.
Então ele ouviu claramente - o rosnado surdo e longo, quase como o ronronar de um gato, que vinha do outro lado das árvores. Era como o ronronar do maior
gato selvagem já visto. E intermitentemente sentiam uma vibração leve, muito fraca, mas suficiente para fazer tilintar as chaves na ignição do jipe. Então Dodgson
compreendeu: Ele está andando.
Algo muito grande. Andando.
Ao lado dele, King olhava para a frente, atônito, boquiaberto. Dodgson olhou para trás, para Baselton. O professor segurava com força nas costas do banco
da frente.
Uma sombra se moveu entre as samambaias enormes bem na frente deles. A julgar pelo tamanho da sombra, o animal devia ter seis metros de altura e doze de comprimento.
Andava apoiado só nas pernas traseiras, tinha o corpo grande, o pescoço curto e a cabeça muito grande.
Um tiranossauro.
Dodgson hesitou, olhando para a sombra. Seu coração batia loucamente no peito. Pensou em passar para o ninho seguinte, mas confiava na eficiência da caixa.
- Vamos acabar logo com isto. Dê-me a caixa - ele disse.
Baselton entregou a caixa.
- Carregada?
- As baterias estão carregadas - disse King.
- Tudo bem. Então vamos. Exatamente como no primeiro. Eu vou na frente, e vocês dois vêm atrás e trazem os ovos para o carro. Prontos?
- Pronto - disse Baselton.
King não respondeu, olhando para a sombra do animal.
- Que dinossauro é esse? - ele perguntou.
- Um tiranossauro.
- Oh, Jesus - gemeu King.
- Um tiranossauro? - disse Baselton.
- Não importa o que seja - Dodgson disse, irritado. - Sigam o plano como antes. Todos prontos?
- Espere um pouco - disse Baselton.
- E se não funcionar? - perguntou King.
- Já sabemos que funciona - garantiu Dodgson.
- Recentemente foi publicado um fato bastante curioso sobre os tiranossauros - disse Baselton. - Um paleontólogo chamado Roxton fez um estudo do tiranossauro
e concluiu que o cérebro dele não é muito diferente do cérebro do sapo, embora, é claro, muito maior. Ele explica que o sistema nervoso dos tiranossauros só está
adaptado para o movimento. Eles não enxergam as coisas que estão imóveis. Os objetos estáticos são invisíveis para eles.
- Tem certeza disso? - perguntou King.
- E o que diz o artigo - disse Baselton. - E faz sentido. Não podemos esquecer que o dinossauro, com todo o seu tamanho intimidador, tinha na verdade um intelecto
muito pequeno. É perfeitamente lógico que o tiranossauro tenha o equipamento mental de um sapo.
- Eu não sei por que vamos enfrentar este - King disse, nervoso, olhando para a frente. - Ele é muito maior do que os outros.
- E daí? - disse Dodgson. - Ouviu o que George disse. Não passa de um sapo grande. Vamos logo. Saiam desse maldito carro. E não batam as portas.
George Baselton sentiu-se uma grande autoridade, lembrando o que havia lido nas revistas científicas. Estava no papel de sempre, fornecendo informação a quem
não sabia nada sobre o assunto. Mas agora, aproximando-se do ninho, notou com surpresa que seus joelhos tremiam. Suas pernas pareciam feitas de borracha. Sempre
pensou que fosse uma figura de retórica, mas viu que a expressão era literalmente verdadeira. Mordeu o lábio e fez um esforço para se controlar. Não ia demonstrar
medo, pensou. Ele era dono daquela situação.
Dodgson caminhou para a clareira, levando a caixa como se fosse um revólver. Baselton olhou para King, que estava com uma palidez de morte e suando profusamente.
Parecia prestes a ter um colapso e caminhava devagar. Baselton ficou ao lado dele para ter certeza de que King estava bem.
Dodgson olhou para trás e fez sinal para os dois homens se aproximarem dele. Olhou para King e para Baselton e atravessou a folhagem entrando na clareira.
Baselton viu o tiranossauro. Não - eram dois! Estavam um de cada lado do monte de terra, dois adultos, seis metros de altura, de pé nas patas traseiras, poderosos,
vermelho-escuros, com mandí-bulas cruéis. Como os maiassauros, olharam para Dodgson por um momento, como que surpresos por ver um intruso. Então os tiranossauros
rugiram furiosos. Um rugido profundo, de uma intensidade incrível, rasgou o ar.
Dodgson levantou a caixa e apontou para os animais. Imediatamente o som alto e estridente encheu a clareira.
Os tiranossauros rugiram em resposta e ergueram a cabeça, estendendo os pescoços para a frente, abrindo e fechando as mandíbulas, preparando-se para o ataque.
Eram enormes - e o som não os afetava. Começaram a dar a volta no monte de terra, caminhando para Dodgson. A terra tremia a cada passo.
- Oh, droga - disse King.
Mas Dodgson não perdeu a calma e girou o botão da caixa. Baselton tapou os ouvidos com as mãos. O som era extremamente alto, contundente, insuportável. A
resposta foi imediata. Os tiranossauros pararam, como se tivessem recebido um golpe muito forte. Abaixaram a cabeça e piscaram os olhos rapidamente. O som parecia
vibrar no ar. Eles rugiram outra vez, mas com menos força, sem muita convicção. Uma gritaria terrível vinha do ninho.
Dodgson avançou, com a caixa no ar, apontada para os animais. Os tiranossauros recuaram, olhando para dentro do ninho, depois para Dodgson. Balançavam as
cabeças para trás e para a frente com rapidez, como tentando livrar os ouvidos do som, que era agora dolorosamente insuportável.
Dodgson começou a subir na parte lateral do monte de terra. Baselton e King fizeram o mesmo. Baselton olhou para baixo e viu quatro ovos brancos mosqueados
e dois filhotes, que pareciam perus magricelas e enormes. Ou uma forma qualquer de pássaro gigante.
Os dois tiranossauros estavam na outra extremidade da clareira, detidos pelo som. Como os maiassauros, a agitação os fez urinar. Batiam os pés, mas não se
aproximavam.
Para ser ouvido no meio do ruído infernal, Dodgson gritou:
- Apanhem os ovos!
Atordoado, King desceu para dentro do ninho e apanhou o primeiro ovo que viu. Suas mãos estavam trêmulas, o ovo fugiu dos seus dedos, e, para apanhá-lo no
ar, ele recuou e pisou na perna de um dos filhotes, que gritou de medo e de dor.
Os tiranossauros tentaram avançar quando ouviram os gritos do filhote. King saltou agilmente para fora do ninho e desapareceu no meio da folhagem. Baselton
o viu deixar a clareira.
- George! - gritou Dodgson, sempre apontando a caixa para os tiranossauros. - Apanhe o outro ovo!
Baselton virou e olhou para os tiranossauros adultos. Viu sua agitação, sua fúria, viu as mandíbulas abrindo e fechando e de repente teve a sensação de que,
com som ou sem ele, aqueles animais não iam permitir que mais ninguém entrasse no ninho. Não teria a mesma sorte de King, pensou. Ele sentia isso e...
- George! Agora!
- Eu não posso! - gritou Baselton.
- Seu cretino de merda! - Segurando a caixa bem no alto, Dodgson começou a descer para dentro do ninho. Mas quando virou o corpo, a bateria se desligou da
caixa.
O som parou bruscamente.
A clareira ficou em silêncio.
Baselton gemeu.
Os tiranossauros sacudiram a cabeça pela última vez e rugi-ram.
Baselton viu Dodgson ficar imóvel, com o corpo rígido, e fez a mesma coisa, obrigando-se com esforço a ficar onde estava, forçando os joelhos a pararem de
tremer. Conteve a respiração.
E esperou.
No outro lado da clareira, os tiranossauros começaram a avançar para ele.

- O que eles estão fazendo? - exclamou Arby, no trailer. Estava tão perto do monitor que seu nariz quase tocava a tela. - Será que enlouqueceram? Estão lá
parados.
Kelly, ao lado dele, não disse nada, olhando para a tela em silêncio.
- Você queria estar lá agora, Kel? - Arby perguntou.
- Ora, cale a boca - Kelly disse.
- Não, não enlouqueceram - Malcolm disse, no rádio, olhando para o monitor do painel do Explorer, enquanto seguiam a trilha a caminho do setor oeste da ilha.
Thorne estava dirigindo, Sarah e Malcolm no banco de trás.
- Ele devia estar tentando religar a máquina de som - Sarah disse. - Será que eles vão mesmo ficar lá parados?
- Vão - disse Malcolm.
- Por quê?
- Estão mal-informados - ele respondeu.

DODGSON


Dodgson viu o tiranossauro avançar para ele. Para animais tão grandes, moviam-se com muita cautela. Só um dos pais se aproximava deles, e, embora parasse
para rugir uma vez ou outra, parecia estranhamente hesitante, como que perplexo por ver que os homens continuavam ali. Ou talvez não os pudesse ver. Talvez ele e
Baselton tivessem se tornado invisíveis para os tiranossauros.
O outro tiranossauro ficou para trás, no outro lado do ninho, balançando a cabeça, muito agitado.
Agitado, mas sem atacar.
E claro que os rugidos do dinossauro que caminhava para ele eram de gelar o sangue. Dodgson não ousava olhar para Baselton, a poucos metros dele. Provavelmente
Baselton estava molhando a calça, pensou Dodgson. Se corresse, era um homem morto. Se ficasse completamente imóvel, tudo ia dar certo.
Com o corpo rígido, Dodgson segurava a caixa na mão esquerda, na altura da cintura. Com a mão direita, puxava vagarosamente o fio desligado. Mais alguns segundos
e poderia ligar a bateria outra vez.
Enquanto isso, não tirava os olhos do tiranossauro. O solo estremecia sob seus pés. Ouvia os gritos do filhote pisado por King. Os gritos pareciam perturbar
os pais, encorajá-los ao ataque.
Não importava. Mais alguns segundos e a bateria estaria ligada. E então...
O tiranossauro estava muito perto. Dodgson sentia o cheiro de podre do carnívoro. O animal rugiu, e ele sentiu o hálito quente. O tiranossauro estava ao lado
de Baselton. Dodgson virou a cabeça uma fração de milímetro para ver o que ia acontecer.
Baselton continuava completamente imóvel. O tiranossauro chegou mais perto, abaixou a cabeça enorme e bufou para Baselton. Depois levantou a cabeça outra
vez, perplexo.
Ele não pode mesmo vê-lo, pensou Dodgson.
O tiranossauro soltou um rugido feroz. Baselton continuou imóvel. O tiranossauro inclinou a cabeça outra vez. Abriu e fechou a boca. Baselton olhava fixo
para a frente, sem piscar. Dilatando as narinas enormes, o tiranossauro o farejou, aspirando o ar longamente, fazendo adejar a frente da calça do homem imóvel.
Então o tiranossauro encostou o focinho em Baselton. Nesse momento Dodgson compreendeu que o animal estava vendo Baselton, e então o tiranossauro balançou
a cabeça para o lado, arremeteu e atingiu Baselton, atirando-o no chão. Baselton gritou quando a pata enorme do animal desceu sobre ele, prendendo-o contra o solo.
Ele ergueu os braços e gritou "Seu filho da mãe!" no momento em que a cabeça desceu e a boca aberta se fechou no seu braço. Foi um movimento delicado, quase gracioso,
mas imediatamente a cabeça se levantou com violência, rasgando a carne. Dodgson ouviu o grito e viu uma coisa pequena e flácida pendurada na boca do animal. Era
o braço de Baselton. A mão balançava no ar e a pulseira de metal do relógio cintilava debaixo do olho enorme do tiranossauro.
Baselton estava gritando, um som contínuo e monótono e o suor brotou em todo o corpo de Dodgson. Então ele deu meia-volta e correu para o carro, para a segurança,
para qualquer coisa.
Ele correu.

Kelly e Arby deram as costas para o monitor no mesmo instante. Kelly estava nauseada. Não podia olhar. Mas pelo rádio ouviam ainda os gritos cada vez mais
fracos do homem deitado no chão, enquanto o tiranossauro o fazia em pedaços.
- Desligue - Kelly disse.
Logo depois os gritos cessaram.
Kelly suspirou e curvou os ombros para a frente.
- Obrigada, Arby.
- Eu não fiz nada - ele disse.

Ela olhou outra vez para a tela e logo ficou de costas outra vez. O tiranossauro estava rasgando alguma coisa vermelha. Kelly estremeceu.
Estava tudo quieto no trailer. Kelly ouvia o zumbido dos contadores eletrônicos, e as bombas de água debaixo do assoalho. Lá fora, o vento farfalhava a relva.
De repente ela se sentiu muito só, muito isolada naquela ilha.
- Arby, o que vamos fazer?
Arby não respondeu e correu para o banheiro.

- Eu sabia - Malcolm disse, olhando para o monitor no painel. - Eu sabia que isso ia acontecer. Eles tentaram roubar os ovos. Agora, veja, os tiranossauros
estão indo embora. Os dois! - Apertou o botão transmissor - Arby? Está me ouvindo?
- Não podemos falar - Kelly disse.
O Explorer continuou a descer a encosta, na direção do ninho do tiranossauro. Thorne segurava a direção com força e disse, sombrio:
- Que maldita confusão.
- Kelly? Está ouvindo? Não podemos ver o que está acontecendo lá. Os tiranossauros deixaram o ninho! Kelly? O que está acontecendo?

Dodgson correu para o jipe. Abateria caiu do seu cinto, mas ele não parou. Lá na frente, viu King no jipe, esperando, tenso e pálido. Dodgson sentou na frente
da direção e ligou o motor. Os tiranossauros rugiram.
- Onde está Baselton? - King perguntou.
- Não conseguiu.
- O que quer dizer?
- Quero dizer que ele não conseguiu porra nenhuma! - gritou Dodgson, engatando a marcha do carro. O jipe partiu, e começou a subir a colina. Os tiranossauros
rugiam atrás deles.
Segurando o ovo, King olhou para trás.
- Talvez seja melhor nos desfazermos disto - ele disse.
- Não se atreva! - disse Dodgson.
King abaixou o vidro.
- Talvez ele só queira o ovo de volta.
- Não - disse Dodgson. - Não! - Estendeu o braço, lutando com King para impedir que ele jogasse o ovo fora.
A trilha era estreita, com valas profundas. O jipe seguia aos saltos.
De repente um dos tiranossauros surgiu do meio das árvores, na frente deles, e ficou parado, rosnando, bloqueando a estrada.
- Oh, Cristo - disse Dodgson, pisando rapidamente no freio. O carro derrapou na trilha de lama e parou.
O tiranossauro caminhou para eles, rugindo.
- Dê a volta! - berrou King. - Dê a volta!
Mas Dodgson não deu a volta. Engatou a marcha à ré e começaram a voltar pela trilha, acelerando, na estrada estreita.
- Você é louco! - King disse. - Vai nos matar! Dodgson acertou King com a mão aberta.
- Cala essa merda de boca! - ele gritou. Dirigir de marcha à ré naquela velocidade exigia toda a sua atenção. Sabia que o tiranossauro era mais rápido. Não
ia dar certo. Estavam num maldito jipe com uma maldita capota de lona e iam ser mortos e...
- Não! - gritou King.
Atrás Dodgson viu o segundo tiranossauro, correndo na trilha, na direção deles. Olhou para a frente e viu o primeiro tiranossauro avançando. Estavam encurralados.
Em pânico, ele girou a direção, o carro saiu da estrada, de marcha à ré, e entrou no mato denso, batendo numa árvore. Dodgson sentiu o impacto violento. A
traseira do carro se inclinou para baixo, e ele compreendeu que as rodas traseiras estavam suspensas no ar, no alto da encosta. Ele acelerou freneticamente, mas
as rodas giraram em falso. Era impossível. Lentamente, o carro deslizou para trás, para a folhagem densa. Dodgson não via nada. Mas estavam suspensos no ar. Ao lado
dele, King soluçava. O tiranossauro rugia muito perto agora.
Dodgson abriu a porta do carro e saltou no espaço. Rolou pela folhagem, caiu, bateu no tronco de uma árvore e rolou pela encosta íngreme de mato fechado.
Em dado momento sentiu uma dor aguda na testa e viu estrelas por um instante, antes de tudo escurecer e ele perder a consciência.

A DECISÃO


Estavam dentro do Explorer, no topo do rochedo que dava para o vale do leste no meio da selva. Os vidros estavam abaixados. Ouviam os rugidos dos tiranossauros
passando velozmente pelo meio do mato alto e entre as árvores.
- Os dois deixaram o ninho - Thorne disse.
- E. Aquele caras devem ter tirado alguma coisa. - Malcolm suspirou.
Ficaram em silêncio, escutando.
Ouviram um zumbido fraco, e Eddie parou a moto ao lado do carro.
- Achei que precisavam de ajuda. Vão descer?
Malcolm balançou a cabeça.
- Não, decididamente, não. É muito perigoso. - Não sabemos onde eles estão.
Sarah Harding disse.
- Por que Dodgson ficou parado daquele jeito? Não é assim que se age na presença de predadores. Quando nos vemos ameaçados por um leão, fazemos muito barulho,
agitamos os braços, jogamos coisas nele. Tentamos assustá-lo. Não se fica parado, esperando.
- Provavelmente ele leu o artigo errado. - Malcolm balançou a cabeça. - Apareceu uma teoria segundo a qual os tiranossauros só podem ver coisas em movimento.
Um cara chamado Roxton fez uns estudos e concluiu que o tiranossauro tem o cérebro de um sapo.
Levine disse no rádio:
- Roxton é um idiota. Não sabe anatomia suficiente para fazer sexo com a própria mulher. Seu artigo é uma piada.
- Que artigo? - perguntou Thorne. Levine continuou, no rádio:
- Roxton acreditava que o tiranossauro tivesse um sistema visual igual aos do anfíbios, como o de um sapo. O sapo vê o movimento mas não vê o que está imóvel.
Mas é completamente impossível um predador ter esse tipo de sistema visual. Completamente impossível porque a defesa mais comum da presa é ficar imóvel. Um gamo,
ou coisa parecida, quando percebe o perigo, fica imóvel. O predador tem de ser capaz de ver a presa. E é claro que os tiranossauros viam.
Levine bufou com desprezo.
- É como a teoria idiota apresentada por Grant alguns anos atrás de que o tiranossauro podia ficar confuso com uma tempestade porque não estava adaptado
aos climas chuvosos. É outro absurdo. O Cretáceo não foi um período de seca. E, de qualquer modo, os tiranossauros eram animais da América do Norte - só foram encontrados
no Canadá e nos Estados Unidos. Os tiranossauros rex viviam nas praias do interior, a leste das Montanhas Rochosas. São comuns as tempestades nas encostas das montanhas.
Tenho certeza de que os tiranossauros viram muita chuva e que evoluíram de modo a conviver com ela.
- Então não existe nada que impeça o tiranossauro de atacar alguém? - perguntou Malcolm.
- É claro que existe. A coisa mais óbvia - disse Levine.
- Qual é?
- Se ele não estiver com fome. Se acabou de comer outro animal. Qualquer coisa maior do que uma cabra satisfaz sua fome durante horas. É isso aí. O tiranossauro
enxerga muito bem, objetos móveis ou imóveis.

Ouviam os rugidos vindos do vale, lá embaixo. Viam o movimento no mato cerrado, mais ou menos quatrocentos metros ao norte de onde estavam. Mais rugidos.
Os dois rex pareciam responder um ao outro.
- Que armas nós temos? - Sarah perguntou.
- Três Lindstradts. Carregadas - disse Thorne.
- Muito bem - ela disse. - Então vamos. Ouviram o rádio outra vez.
- Eu não estou aí - Levine disse. - Mas meu conselho é que devem esperar.
- Para o diabo com a espera - disse Malcolm. - Sarah tem razão. Vamos até lá para ver o que aconteceu.
- Seu funeral - disse Levine.

Arby voltou para o monitor, enxugando o queixo e ainda um pouco verde.
- O que eles estão fazendo agora?
- O Dr. Malcolm e os outros vão até o ninho.
- Está brincando? - ele disse, alarmado.
- Não se preocupe - Kelly disse. - Sarah pode resolver tudo.
- É o que você espera - disse Arby.

O NINHO


Pararam o Explorer um pouco além da clareira. Eddie encostou a moto no tronco de uma árvore e esperou que os outros descessem do carro.
Sarah Harding sentiu o cheiro ácido, que conhecia tão bem, de carne podre e excremento, característico dos ninhos dos carnívoros. No calor da tarde, era um
pouco enjoativo. Moscas zumbiam no ar parado. Harding apanhou um dos rifles e passou a correia pelo ombro. Olhou para os três homens, todos imóveis, tensos. Malcolm
tinha uma orla branca em volta da boca e o rosto muito pálido. Sarah lembrou de quando seu velho professor Coffmann a visitara na África. Coffmann era um desses
tipos que faziam a linha Hemingway, gostava de uma bebida, tinha vários casos amorosos no lugar em que vivia e várias histórias de aventuras com os orangotangos
em Sumatra, os lêmures de cauda enrolada de Madagascar. Ela o levara ao local de caça dos carnívoros na savana. E ele imediatamente desmaiou. Coffmann pesava mais
de cem quilos e Sarah teve de arrastá-lo pelo colarinho, com os leões em volta deles, rosnando. Foi um boa lição para ela.
Inclinou-se para os três homens e murmurou:
- Se alguém tem alguma dúvida, não vá. Espere aqui. Não quero me preocupar com vocês. Posso fazer isso sozinha.
- Tem certeza?
- Tenho. Agora, fiquem quietos.
Sarah caminhou para a clareira e eles se apressaram em segui-la. Ela afastou as folhas das samambaias e entrou na clareira. Os tiranossauros não estavam e
o cone de terra estava deserto. À direita ela viu um pé de sapato com um pedaço de carne aparecendo na parte superior da meia rasgada. Era tudo o que tinha sobrado
de Baselton. Ouviu um grito fraco e queixoso que vinha de dentro do ninho. Sarah subiu no muro baixo de terra com Malcolm atrás dela. Viu dois filhotes de tiranossauro,
choramingando. Ao lado deles havia três ovos grandes. Viram marcas de pés por toda a parte, na lama.
- Eles levaram um ovo - disse Malcolm. - Droga.
- Você não queria que nada perturbasse seu pequeno ecossistema?
- Sim, era o que eu esperava - Malcolm disse, com um sorriso.
- É uma pena - Sarah disse, caminhando rapidamente na borda do ninho. Inclinou-se e olhou para os filhotes de tiranossauros. Um deles se encolheu, encostando
o pescoço penugento no corpo. Mas o segundo não fez nenhum movimento quando ela se aproximou. Continuou deitado de lado, respirando rapidamente, com os olhos vidrados.
- Este está ferido - ela disse.

Levine estava de pé no posto de observação. Apertou o fone preso na cabeça ao ouvido e falou no microfone perto da boca.
- Preciso de uma descrição - ele disse.
- São dois - disse Thome. - Mais ou menos sessenta centímetros de comprimento; peso, cerca de vinte quilos. Do tamanho de um pequeno avestruz. Olhos grandes.
Focinhos curtos. Cor marrom-clara. E têm um anel de penugem em volta do pescoço.
- Podem ficar de pé?
- Bem... se podem, não muito bem. Estão mais ou menos se íirrastando. Guinchando muito.
- Então são recém-nascidos - disse Levine. - Provavelmente têm poucos dias. Nunca saíram do ninho. Eu teria muito cuidado.
- Por quê?
- Com filhotes tão novos - disse Levine -, os pais não ficam longe por muito tempo.
Harding chegou mais perto do filhote machucado. Sempre choramingando, ele tentou se arrastar para ela, desajeitadamente. Uma das pernas estava dobrada num
ângulo estranho.
- Acho que está com a perna esquerda machucada. Eddie se aproximou para ver.
- Está quebrada?
- Sim, provavelmente, mas...
- Ei - Eddie disse. O filhote avançou e mordeu a bota dele na altura do tornozelo. Eddie puxou o pé, arrastando o animal, que não soltou a bota. - Ei! Largue
daí!
Eddie levantou a perna e sacudiu de um lado para o outro, mas o filhote não largou. Ele puxou por mais um momento, depois parou. O filhote ficou deitado no
chão, com a respiração curta, as mandíbulas firmes em volta da bota de Eddie.
- Nossa - ele disse.
- Criaturinha agressiva, não é mesmo? - Sarah disse. - f Desde que nascem...
Eddie olhou para os dentes pequenos e afiados. Não tinham penetrado o couro, mas o filhote continuava firme. Eddie empurrou o animal com a coronha do rifle
várias vezes. Não adiantou. O filhote piscava os olhos olhando para ele, mas não soltava os dentes.
Ouviram os rugidos distantes dos pais, em algum lugar ao norte.
- Vamos sair daqui - Malcolm disse. - Já vimos o que viemos ver. Temos de descobrir para onde Dodgson foi.
- Acho que vi uma marca na trilha - Thorne disse. - Eles devem ter ido para aquele lado.
- É melhor darmos uma olhada.
Começaram a andar na direção do carro.
- Esperem um pouco - Eddie disse, olhando para o pé. - O que vou fazer com este filhote?
- Dê um tiro nele - Malcolm disse.
- Quer dizer, matar?
- Ele está com a perna quebrada, Eddie - Sarah disse. - De qualquer modo vai morrer.
- Sim, mas...

- Vamos voltar pela trilha, Eddie - Thorne disse. - E se não encontrarmos Dodgson, pegamos a estrada do penhasco para o laboratório. Depois, voltamos para
o trailer.
- Tudo bem, Thorne. Estou bem atrás de vocês. - Eddie ergueu o rifle e o girou nas mãos.
- Faça isso agora - disse Sarah, entrando no Explorer. - Não vai querer estar aqui quando o papai e a mamãe voltarem, não é mesmo?

A RUÍNA DO JOGADOR


Dirigindo o Explorer na trilha, Malcolm olhou para o monitor no painel. As imagens mudavam, passando de uma câmara de vídeo para outra. Ele procurava Dodgson
e seus companheiros. Levine disse no rádio:
- Foi muito grave?
- Eles levaram um ovo - disse Malcolm. - E tivemos de matar um dos filhotes.
- Então, duas perdas. Num total de quanto, seis?
- Sim, seis.
- Francamente, eu diria que não é importante - disse Levine. - Desde que vocês impeçam aquela gente de fazer mais alguma coisa.
- Estamos à procura deles agora - disse Malcolm, desanimado.
- Tinha de acontecer, Ian - Sarah disse. - Sabe que não pode observar um animal sem mudar alguma coisa. É uma impossibilidade científica.
- E claro - disse Malcolm. - Essa é a maior descoberta científica isolada do século XX. Não se pode estudar uma coisa sem mudá-la.
Desde Galileu os cientistas adotaram a posição de observadores objetivos do mundo natural. Isso estava implícito em todos os aspectos do seu comportamento,
mesmo no modo como redigiam seus trabalhos científicos, usando expressões como "foi observado..." Como se ninguém tivesse observado. Durante trezentos anos essa
atitude impessoal foi a marca registrada da ciência. A ciência era objetiva, e o observador não tinha influência nos resultados que descrevia.
Essa objetividade tornava a ciência diferente das ciências humanas, bem como da religião - campos de estudo onde o ponto de vista do observador era parte
integrante, onde o observador estava definitivamente ligado aos resultados observados.
Porém no século XX essa diferença desapareceu. A objetividade científica não mais existe nem mesmo no nível mais fundamental. Os físicos sabem agora que não
é possível sequer medir uma única partícula subatômica sem afetá-la em sua totalidade. Se inserimos instrumentos para medir a posição de uma partícula, mudamos sua
velocidade. Se medimos sua velocidade, mudamos sua posição. Essa verdade básica tornou-se o princípio da incerteza de Heisenberg, segundo o qual qualquer coisa que
estudamos nós mudamos. No fim, ficou claro que todos os cientistas são participantes num universo participativo que não permite a ninguém ser um mero observador.
- Eu sei que a objetividade é impossível - Malcolm disse, impaciente. - Não é isso o que me preocupa.
- Então o que o preocupa?
- A Ruína do Jogador - disse Malcolm, olhando para o monitor.
xxx
A Ruína do Jogador é um fenômeno estatístico muito conhecido e muito debatido, que teve conseqüências importantes tanto para a evolução quanto para a vida
quotidiana.
- Digamos que você seja um jogador - ele disse. - E está jogando uma moeda. Sempre que cai cara, você ganha um dólar. Sempre que cai coroa, você perde um
dólar.
- Muito bem...
- O que acontece depois de um tempo? Harding deu de ombros.
- As chances de tirar cara ou coroa são iguais. Então, você pode ganhar ou perder. Mas no fim chega a zero.
- Infelizmente, não - disse Malcolm. -Se você jogar por um longo tempo, sempre vai perder: o jogador sempre fica arruinado. Por isso os cassinos continuam
abertos. Mas a questão é, o que acontece com o passar do tempo? O que acontece no período que antecede à ruína do jogador?
- Tudo bem. O que acontece?
- Se fizer um gráfico da sorte do jogador durante um longo tempo, o que vai encontrar é que ele ganha durante um período ou perde durante um período. Em outras
palavras, tudo no mundo acontece periodicamente. É um fenômeno real, e nós o vemos por toda a parte. No tempo, nas enchentes dos rios, no beisebol, nos ritmos do
coração, na Bolsa de Valores. Quando as coisas começam a ir mal, a tendência é continuar mal. Como diziam os antigos, as coisas ruins sempre vêm em grupo de três.
A teoria da complexidade nos diz que a sabedoria popular está certa. As coisas más se juntam e tudo vai junto para o inferno. Esse é o mundo real.
- Então, o que você está dizendo? Que as coisas estão indo para o inferno agora?
- Pode ser, graças a Dodgson - Malcolm disse, observando o monitor. - Afinal, o que aconteceu com aqueles filhos da mãe?

KING


Howard King, recuperando aos poucos a consciência, ouvia vagamente um zumbido, como o som de uma abelha distante. Abriu os olhos e viu o pára-brisa de um
carro no meio de galhos de árvores.
O zumbido estava mais forte.
King não sabia o que era. Não lembrava como fora parar ali, o que tinha acontecido. Sentia dor nos ombros e nos quadris. Sua cabeça latejava. Tentou lembrar,
mas a dor o impedia de pôr em ordem as idéias. A última coisa de que lembrava era o tiranossauro na sua frente, na estrada. Essa era a última coisa. Então Dodgson
olhou para trás e...
King virou a cabeça e a dor lancinante no pescoço e na cabeça o fez soltar um grito. A dor quase o deixou sem ar. Fechou os olhos. Então, abriu outra vez,
bem devagar.
Dodgson não estava no carro. A porta do motorista estava aberta com uma sombra escura na parte interior. As chaves estavam na ignição.
Dodgson não estava em lugar algum.
King viu uma mancha longa de sangue na parte superior da direção. A caixa preta estava no chão, ao lado da embreagem. A porta aberta rangeu um pouco, moveu
um pouco.
A distância ele ouvia ainda o zumbido, como abelhas gigantes. Então percebeu que era um som mecânico. Alguma coisa mecânica.
King pensou no barco. Até quando o barco os esperaria no rio? Olhou para o relógio. O vidro estava quebrado, os ponteiros parados em 1:54.
Ouviu o zumbido outra vez, cada vez mais perto.
Com esforço, King se inclinou para a frente. Pontadas agudas castigaram sua coluna, mas logo passaram. Ele respirou fundo.
Eu estou bem, pensou. Pelo menos ainda estou aqui.
Olhou para fora, pela porta aberta. O sol ainda estava alto. Devia ser o começo da tarde. Quando o barco ia partir? Quatro horas? Cinco? Ele não lembrava.
Mas tinha certeza de que aqueles pescadores latinos não ficariam na ilha quando começasse a escurecer. Iriam embora.
E Howard King queria estar no barco quando eles se fossem. Era a única coisa que queria no mundo. Com esforço, passou para o banco do motorista. Respirou
fundo, estendeu o braço e fechou a porta.
O carro estava suspenso no espaço, seguro pelas árvores. Ele viu uma encosta íngreme logo abaixo. Estava escuro debaixo das copas fechadas das árvores. Ficou
tonto só de olhar para baixo. A encosta devia ter uns seis ou dez metros de altura. Viu samambaias verdes espalhadas e algumas rochas negras. Girou o corpo para
ver mais.
E então ele o viu.
Dodgson estava deitado de costas, de cabeça para baixo, na encosta, com o corpo encolhido, pernas e braços em posição estranha. Estava imóvel. King não o
via muito bem, no meio da folhagem densa, mas Dodgson parecia morto.
O zumbido de repente ficou muito alto, crescendo a cada segundo. King olhou para a frente e viu, através da folhagem que bloqueava o pára-brisa, um carro
passando na trilha, a menos de dez metros dele. Um carro!
O carro passou. Pelo som parecia um carro elétrico. Então devia ser Malcolm.
A idéia de que havia outras pessoas na ilha era animadora. King sentiu sua força renovar, a despeito das dores. Estendeu o braço e ligou a chave. O motor
pegou.
Ele engatou a marcha e pisou de leve no acelerador.
As rodas traseiras rodaram em falso. Ele ligou a tração dianteira. Imediatamente o jipe saltou para a frente, entre os galhos. Um momento depois, King estava
na estrada.
Lembrou daquela estrada. Para a direita, ia dar no ninho dos tiranossauros. O carro de Malcolm fora para a esquerda.
King virou para a esquerda e seguiu em frente. Tentava lembrar o caminho para o rio, para o barco. Lembrou vagamente que havia uma bifurcação no topo da colina.
Resolveu tomar a estrada que descia e sair daquela ilha maldita.
Esse era seu objetivo.
Sair da ilha antes que fosse tarde demais.

MÁS NOTÍCIAS


O Explorer chegou ao topo da colina e Thorne entrou na estrada do penhasco, cortada na face da rocha e cheia de curvas fechadas. Em vários pontos seguia à
beira de precipícios, mas lá de cima podiam ver toda a ilha. Finalmente chegaram ao lugar de onde viam bem o vale. Viam o abrigo à esquerda e perto, na clareira,
os dois trailers. A direita estava o complexo do laboratório e o conjunto de casas dos trabalhadores mais além.
- Não vejo Dodgson em lugar algum - Malcolm disse, sombriamente. - Para onde ele pode ter ido?
Thorne ligou o rádio.
- Arby?
- Sim.
- Você vê alguém?
- Não, mas... - Ele hesitou.
- O quê?
- Vocês não querem voltar para o trailer agora? E simplesmente espantoso.
- O que é espantoso? - quis saber Thorne.
- Eddie - Arby disse. - Ele acaba de chegar. E trouxe o filhote com ele.
Malcolm inclinou para a frente.
- Ele fez o quê?


QUINTA CONFIGURAÇÃO


No limite do caos, resultados inesperados ocorrem. O risco para a sobrevivência é grande.


IAN MALCOLM

O FILHOTE


No trailer todos rodeavam a mesa onde o filhote de tiranossauro rex estava inconsciente numa bandeja de aço inoxidável, os olhos grandes fechados, o focinho
debaixo da máscara de plástico de oxigênio. A máscara quase servia perfeitamente no focinho redondo. O oxigênio zumbia discretamente.
- Eu não podia deixá-lo - Eddie disse. - E achei que podemos consertar esta perna...
- Mas, Eddie... - Malcolm balançou a cabeça.
- Então apliquei uma dose grande de morfina da caixa de primeiros-socorros e o trouxe para cá. Estão vendo? A máscara de oxigênio serve nele.
- Eddie, o que você fez foi errado - disse Malcolm.
Levine disse no rádio.
- Uma grande insensatez. Muito grande.
- Muito obrigado, Richard - Thorne disse.
- Sou inteiramente contrário a levarem o animal para o trailer.
- Tarde demais para se preocupar com isso agora - Sarah Harding disse. Ela estava ao lado do filhote, aplicando os medidores cardíacos no peito do animal.
Eles ouviam as batidas do coração. Eram muito rápidas. Mais de cento e cinqüenta por minuto. - Quanta morfina você deu? - ela perguntou.
- Ora, eu dei... você sabe. A seringa toda.
- Quanto é isso, dez cc?
- Talvez mais. Uns vinte.
- Quanto tempo vai durar o efeito? - Malcolm perguntou a Harding.
Não tenho idéia. Já apliquei sedativos em leões e chacais no campo para etiquetá-los. Com esses animais, há uma vaga correlação entre a dose e o peso corporal.
Mas com filhotes é imprevisível. Alguns minutos, talvez algumas horas. E eu não sei coisa alguma sobre filhotes de tiranossauros. Basicamente é uma função do metabolismo,
e o dele parece ser rápido, como de um passarinho. O coração está batendo muito depressa. Tudo o que posso dizer é que precisamos tirá-lo daqui o mais depressa possível.
Harding apanhou o pequeno aparelho de ultra-sonografia e o encostou na perna do filhote, olhando para trás, para o monitor. Kelly e Arby estavam na frente
da tela.
- Por favor, afastem-se um pouco. - Eles obedeceram. - Não temos muito tempo. Por favor.
Sarah viu os contornos verdes e brancos da perna e dos ossos. Surpreendentemente parecidos com os de um pássaro, pensou ela. Um abutre ou uma cegonha. Ela
apontou para o monitor.
- Muito bem... aqui estão os ossos do metatarso... e aqui a tíbia e o perônio, os dois ossos da perna...
- Por que os ossos têm cores diferentes? - perguntou Arby. A tela mostrava algumas partes brancas densas dentro de contornos verde-claros.
- Porque é um filhote - disse Harding. - As pernas são quase inteiramente de cartilagens, com poucos ossos calcificados. Acho que ele ainda não pode andar
- pelo menos, não muito bem. Aqui. Vejam a rótula. Podem ver o fornecimento de sangue para a junta...
- Como é que você sabe tanto de anatomia? - perguntou Kelly.
- Eu passo muito tempo examinando a caça de predadores, estudando os pedaços de ossos que eles deixam nos locais de caça, para determinar que animais foram
abatidos. Para isso preciso conhecer muito bem anatomia comparada. - Moveu o aparelho na perna quebrada. - E meu pai era veterinário.
Malcolm ergueu a cabeça bruscamente.
- Seu pai era veterinário?
- Era. No zoológico de San Diego. Especialista em pássaros. Mas não entendo por quê... Pode ampliar isto?
Arby apertou um botão e a imagem ficou duas vezes maior.
- Ah. Muito bem. Aqui está. Podem ver? !
- Não.
- No centro do perônio. Estão vendo? Uma linha escura muito fina. Isso é uma fratura, logo acima da epífise.
- Esta linha escura aqui? - perguntou Arby.
- Essa linha escura significa a morte para este filhote - disse Sarah. - O perônio não vai soldar em linha reta, impedindo o movimento da junta quando ele
ficar de pé. O filhote não vai poder correr e provavelmente nem mesmo andar. Aleijado, logo será apanhado por um predador.
- Mas podemos consertar isso - disse Eddie.
- Muito bem - Sarah disse. - O que vamos usar como "gesso?"
- Diesterase - respondeu Eddie. - Eu trouxe quilos de diesterase em tubos de cem cc. Uma grande quantidade de cola. E um polímero de resina que solidifica
e fica duro como aço.
- Ótimo - disse Harding. - Isso vai matá-lo também.
- Por quê?
- Eddie, ele está crescendo. Em poucas semanas vai estar muito maior. Precisamos de alguma coisa rígida, mas biodegradável. Alguma coisa que gaste ou se
quebre dentro de três a cinco semanas, o tempo para o osso soldar. O que você tem?
- Não sei - disse Eddie.
- Bem, não temos muito tempo - Sarah disse.
- Thorne? Isto é como um dos seus famosos problemas. Como fazer um "gesso" para um dinossauro apenas com cotonetes e supercola?
- Sim, eu sei - disse Thorne, percebendo a ironia. Por três décadas ele havia apresentado problemas desse tipo aos seus alunos de engenharia. Agora era ele
quem tinha de encontrar a solução.
- Talvez seja possível degradar a resina, misturar com alguma coisa, como açúcar.
Thorne balançou a cabeça.
- Os grupos hidroxilas na sacarose farão com que a resina fique friável. Vai endurecer mas quebrar como vidro ao primeiro movimento do animal.
- E se misturarmos com tecido embebido em açúcar?
- Quer dizer, introduzir bactérias para apodrecer o tecido?
- Isso mesmo.
- Então o gesso se quebra?
-Exato.
Thorne deu de ombros.
- Pode dar certo - ele disse. - Mas sem testar primeiro, nunca vamos saber quanto tempo pode durar. Pode ser alguns dias, pode ser alguns meses.
- É muito tempo - disse Sarah. - Este animal cresce depressa. Se for impedido o crescimento da perna, ele fica aleijado.
- O que precisamos é de uma resina orgânica que forme uma faixa que se descomponha. Como uma espécie de goma.
- Goma de mascar? - disse Arby. - Porque eu tenho uma porção...
- Não. Eu estava pensando num tipo diferente de goma. Quimicamente falando, a resina diesterase...
- Nunca conseguiremos dissolvê-la quimicamente - disse Thorne. - Não temos o material necessário.
- O que mais podemos fazer? Não temos escolha senão...
- Que tal fazer uma coisa que seja diferente em direções diferentes? - disse Arby. - Forte numa direção e fraca na outra?
- Não é possível - respondeu Eddie. - É uma resina homogênea. Toda ela do mesmo material, uma cola pegajosa que endurece quando seca e...
- Não, espere um pouco. - Thorne se voltou para Arby. - O que quis dizer com isso, Arby?
- Bem, Sarah disse que a perna está crescendo. Isso significa que vai crescer no comprimento, que um molde de gesso não impediria, e na largura, que o molde
prejudicaria porque ia começar a apertar. Mas se fizerem um molde fraco no sentido do diâmetro...
- Ele tem razão - Thorne disse. - Podemos resolver estruturalmente.
- Como? - perguntou Eddie.
- Fazendo a estrutura do molde com uma abertura vertical. Talvez de papel de alumínio. Temos bastante, para cozinhar.
- É muito fraco - disse Eddie.
- Não se o cobrirmos com uma camada de resina. - Thorne voltou-se para Sarah. - O que podemos fazer é um molde muito forte para a pressão vertical e fraco
para a pressão lateral. É um problema simples de engenharia. O filhote pode andar com o molde desde que a pressão seja vertical. Mas, com o crescimento da perna,
a abertura central vai se abrir e o molde cai.
- Sim - concordou Arby.
- É difícil fazer isso? - perguntou Sarah.
- Não. Deve ser muito fácil. É só fazer uma armação de papel de alumínio e cobrir com resina.
- E como vão manter a armação fechada enquanto passam a resina? - perguntou Eddie.
- Que tal chiclete? - sugeriu Arby.
- É isso aí - disse Thorne, sorrindo.
Nesse momento o filhote acordou e moveu a perna. Abriu os olhos, derrubou a máscara de oxigênio e soltou um gemido surdo.
- Depressa - disse Sarah, segurando a cabeça do animal. - Mais morfina.
Malcolm tinha a seringa pronta e injetou a morfina no pescoço do filhote.
- Só cinco cc agora - recomendou Sarah.
- Por que não mais do que isso? Assim ele dorme mais tempo.
- Ele está em choque por causa da fratura, Ian. Muita morfina pode matá-lo. Provocar uma parada respiratória. Provavelmente suas glândulas supra-renais foram
afetadas também.
- Se é que ele tem supra-renais - disse Malcolm. - Afinal, os dinossauros têm hormônios? A verdade é que não sabemos coisa alguma sobre esses animais.
Levine disse no rádio:
- Fale por você, Ian. Na verdade, suspeito que descobriremos que os dinossauros têm hormônios. Existem várias razões para acreditar nisso. Uma vez que vocês
cometeram o erro de levar o filhote para o trailer, podem retirar algumas amostras de sangue. Enquanto isso, Thorne, quer apanhar o telefone?
Malcolm suspirou.
- Esse cara está começando a me dar nos nervos.
Thorne foi para o módulo de comunicações perto da frente do trailer. O pedido de Levine era estranho, uma vez que tinham um ótimo sistema de microfones em
todos os pontos do trailer. Mas Levine sabia disso, ele mesmo havia projetado o sistema.
Thorne apanhou o telefone.
-Sim?
- Thorme, vou direto ao assunto. Levar o filhote para o trailer foi um erro. E pedir encrenca.
- Que tipo de encrenca?
- O caso é que não sabemos. E não quero alarmar ninguém. Mas, por que não traz os meninos para cá por algum tempo? E por que você e Eddie não vêm também?
- Está me mandando dar o fora daqui? Acha mesmo que é necessário?
- Numa palavra - Levine disse - sim. Acho necessário.

Quando a morfina foi injetada, o filhote suspirou asperamente e caiu deitado na bandeja de aço. Sarah ajustou a máscara de oxigênio outra vez e voltou-se
para verificar o ritmo do coração, mas Arby e Kelly estavam novamente entre ela e o monitor.
- Meninos, por favor.
Thorne voltou da frente do trailer e bateu as mãos.
- Muito bem, meninos. Excursão de campo! Vamos embora.
- Agora? - disse Arby. - Mas nós queremos ver o filhote...
- Não, não. O Dr. Malcolm e a Dra. Harding precisam de espaço para trabalhar. Está na hora de uma viagem até o posto de observação. Podemos observar os dinossauros
até o fim da tarde.
- Mas...
- Não discuta. Estamos atrapalhando aqui e vamos sair. Eddie, você vem também. Deixe os dois pombinhos trabalhando.
Eles saíram, fecharam a porta do trailer e logo Sarah ouviu o zumbido do motor do Explorer. Inclinada ao lado do filhote, ajustando a máscara de oxigênio,
ela disse:
- Pombinhos?
Malcolm deu de ombros.
- Levine...
- Foi idéia de Levine? Mandar todo o mundo sair daqui?
- Provavelmente.
- Ele sabe de algo que não sabemos? Malcolm riu.
- Estou certo de que ele pensa que sabe.
- Muito bem, vamos começar a fazer o molde. Quero acabar depressa e levar esse filhote para casa.

O POSTO DE OBSERVAÇÃO


Quando chegaram ao posto de observação, o sol tinha se escondido atrás das nuvens baixas. Uma luminosidade avermelhada e suave banhava todo o vale. Eddie
parou o Explorer ao lado do andaime de alumínio e todos subiram para o pequeno abrigo. Levine estava observando com o binóculo e não pareceu alegre por vê-los.
- Parem de andar de um lado para o outro - ele disse, irritado. Lá de cima tinham uma vista magnífica do vale. O trovão soou
distante, ao norte. O ar estava esfriando e carregado de eletricidade.
- Vamos ter uma tempestade? - Kelly perguntou.
- Parece que sim - disse Thorne.
Arby olhou desconfiado para o teto do abrigo.
- Até quando vamos ficar aqui?
- Algum tempo - disse Thorne. - É o único dia que temos na ilha. Amanhã de manhã o helicóptero estará aqui. Achei que vocês dois mereciam uma chance de ver
os dinossauros mais uma vez.
Arby entrecerrou os olhos.
- Qual o verdadeiro motivo?
- Eu sei - Kelly disse, muito conhecedora.
- É mesmo? Qual é?
- O Dr. Malcolm quer ficar sozinho com Sarah, seu bobo.
- Por quê?
- Eles são velhos amigos - explicou Kelly. t - E daí? Nós só íamos ficar vendo.
- Não - disse Kelly. - Estou dizendo que são velhos amigos.
- Eu sei o que você está dizendo. Não sou burro, sabia?
- Parem com isso - Levine disse, sem tirar o binóculo dos olhos. - Estão perdendo uma coisa muito interessante.
- O que é?
- Aqueles tricerátops ao lado do rio. Estão preocupados com alguma coisa.
O bando de tricerátops, que até aquele momento bebia pacificamente na margem do rio, começava a fazer barulho. Para animais daquele tamanho, as vozes eram
absurdamente altas e finas, pareciam lobos uivando.
Arby olhou.
- Tem alguma coisa nas árvores, no outro lado do rio - ele disse.
Sombras escuras se moviam entre as árvores.
O bando de tricerátops começou a mudar de posição, costas contra costas, até formarem uma espécie de roseta com os chifres curvos virados para fora, de frente
para a ameaça invisível. O único filhote estava no centro, gritando de medo. Um dos animais, provavelmente a mãe, virou a cabeça e o acariciou com o focinho. Logo
depois o filhote se calou.
- Estou vendo. - Kelly olhava para as árvores. - São raptores. Lá adiante.
Os tricerátops estavam de frente para os raptores, os adultos emitindo sons que pareciam latidos e balançando os chifres cortantes para cima e para baixo.
Formavam uma barreira de armas agudas. A coordenação do bando era inegável, a defesa em grupo contra os predadores.
Levine sorriu feliz.
- Nunca tivemos nenhuma prova disso - ele disse, de repente bem-humorado. - Na verdade, a maioria dos paleontólogos não acredita que pudesse acontecer.
- Não acredita que pudesse acontecer o quê? - perguntou Arby.
- Esse tipo de comportamento de defesa em grupo. Especialmente com os trikes - eles se parecem um pouco com os rinocerontes, por isso são considerados animais
solitários como os rinocerontes. Mas agora estamos vendo... Ah. Sim.
Um único velocirraptor saiu do meio das árvores, movendo-se rapidamente nas patas traseiras, equilibrando o corpo com a cauda esticada rigidamente para trás.
O bando de tricerátops uivou barulhentamente quando o viu. Os outros raptores continuaram escondidos entre as árvores. O velocirraptor, completamente visível,
fez um semicírculo, desvi-ando-se do bando, e mergulhou na água, na outra extremidade da clareira. Nadou com facilidade e saiu na outra margem. Estava agora a cerca
de cinqüenta metros, rio acima, do bando de tricerátops, que giraram juntos, ficando de frente para ele. Toda a sua atenção estava concentrada no único velocirraptor.
Lentamente os outros raptores começaram a sair das árvores, movendo-se abaixados, escondidos entre a relva alta.
- Legal - disse Arby. - Eles estão caçando.
- Em grupo - Levine concordou. Ele apanhou um pedaço de papel de chocolate do chão e o jogou para fora. - Os raptores estão a favor do vento, assim os tricerátops
não podem sentir o cheiro deles. -Levou o binóculo aos olhos. -Eu acho que vamos assistir a uma caçada.
Viram os raptores fechando o cerco em volta do bando de tricerátops. Então, um relâmpago rasgou o céu, iluminando todo o vale. Um dos raptores do grupo ergueu
o corpo, surpreso, e por um pequeno tempo sua cabeça apareceu acima da relva.
Imediatamente o bando de tricerátops girou em conjunto outra vez, reagrupando-se para enfrentar a nova ameaça. Todos os raptores pararam, como para reconsiderar
o plano de ataque.
- O que aconteceu? - perguntou Arby. - Por que eles pararam?
- Estão com problemas.
- Por quê?
- Olhe para eles. A maior parte do grupo está ainda no outro lado do rio. Longe demais para atacar.
- Quer dizer que vão desistir? Já?
- Parece que sim - disse Levine.
Um a um os raptores ergueram as cabeças na relva, revelando sua posição. À medida que eles iam aparecendo, os tricerátops uivavam mais alto. Aparentemente
os raptores reconheceram que nada podiam fazer. Voltaram para as árvores. Vendo a retirada, os tricerátops uivaram mais alto ainda.
Então, o raptor isolado, que estava na margem do rio, atacou. Movendo-se com rapidez incrível -espantosa -atravessou como um leopardo os cinqüenta metros
que o separava do bando. Os tricerátops não tiveram tempo para reformar sua linha de defesa. O filhote, exposto, gritava de medo, vendo o raptor aproximar-se.
O velocirraptor saltou no ar. Outro relâmpago iluminou a clareira e eles viram as garras curvas dos pés do animal prontas para o ataque. No último momento,
o tricerátops mais próximo virou o corpo e com um golpe do chifre forte e afiado atirou o raptor para a margem lamacenta do rio. Imediatamente o tricerátops avançou,
de cabeça erguida. Quando alcançou o raptor, parou e abaixou a cabeça violentamente com o chifre apontado para o corpo do animal caído. Mas o raptor foi rápido.
Sibilando, ele se levantou e o chifre do tricerátops enterrou na lama. O raptor girou para um lado e deu um pontapé no focinho do adversário, tirando sangue com
a garra afiada. O tricerátops urrou, mas dois outros adultos avançaram, enquanto os demais protegiam o filhote. O raptor fugiu correndo entre a relva.
- Nossa! - exclamou Arby. - Foi demais!

O BANDO


Com um suspiro de alívio King chegou à encruzilhada e virou o jipe vermelho para a esquerda, entrando numa estrada larga que o levaria de volta ao barco.
A esquerda ele via o vale do leste. O barco ainda estava lá! Tudo bem! Com um grito de alegria, King acelerou. Via os pescadores no convés, olhando para o céu. Apesar
da tempestade que se aproximava, não pareciam estar se preparando para partir. Provavelmente esperavam Dodgson.
Muito bem, pensou ele, isso era ótimo. Estaria lá dentro de poucos minutos. Depois da caminhada na selva, finalmente podia ver para onde estava indo. A estrada
ficava no alto, acompanhando a crista de uma das cordilheiras vulcânicas. Quase não tinha vegetação e era muito sinuosa. Entre uma curva e outra, ele avistava toda
a ilha. A leste ficava a ravina, com o barco na praia. A oeste ele via o laboratório e os dois trailers de Malcolm na borda da clareira.
Eles não chegaram a descobrir o que Malcolm estava fazendo na ilha. Não que isso importasse agora. King quase sentia o convés do barco sob os pés. Talvez
um dos pescadores tivesse uma cerveja. Uma boa cerveja gelada enquanto descia o rio, saindo daquela ilha maldita. Beberia à saúde de Dodgson. Sim, era isso o que
ia fazer.
Talvez, pensou, eles tenham duas cervejas.
King saiu de uma curva e viu um bando de animais no meio da estrada. Eram uma espécie de dinossauros verdes, com um metro e vinte de altura, cabeças grandes
e uma porção de chifres pequenos. Lembravam os búfalos verdes da água, pensou King. Era um bando enorme. King freou bruscamente, e o jipe deslizou para o lado e
parou.
Os dinossauros verdes olharam para o carro, mas não se moveram. Continuaram descansando preguiçosamente no meio da estrada. King esperou, tamborilando nervoso
na direção. Não aconteceu nada, e ele buzinou e piscou os faróis.
Os animais apenas olharam para o carro.
Eram umas criaturas engraçadas, com a testa curva e saliente e a crista de pequenos chifres. Olhavam para ele como vacas estúpidas. King engatou a marcha
e avançou bem devagar, esperando abrir caminho entre eles. Nenhum se moveu. Finalmente, o pára-choque encostou no animal mais próximo, que rosnou, deu alguns passos
para trás, abaixou a cabeça e deu uma marrada na frente do jipe.
Cristo, pensou King. Eles podiam furar o radiador se não tivesse cuidado. Parou outra vez e esperou com o motor ligado. Os animais voltaram ao descanso.
Vários estavam deitados na estrada. Não podia passar por cima deles. Olhou para o rio e viu o barco, a menos de quatrocentos metros. Não tinha notado que
estava tão perto. Percebeu então a atividade dos pescadores no convés. Estavam recolhendo o guindaste, levando-o para dentro do barco. Preparando-se para partir!
Para o diabo com a espera, pensou King. Abriu a porta e desceu, deixando o carro no meio da estrada. Os animais levantaram imediatamente e o mais próximo
avançou para ele. A porta estava aberta e o dinossauro a fechou com uma marrada, deixando a marca no metal. King correu para a beira do penhasco e viu que estava
no topo de uma descida vertical de mais de trinta metros. Nunca conseguiria descer por ali. Mais adiante, a encosta não era tão íngreme. Mas agora, outros animais
estavam avançando e ele não tinha escolha. Passou correndo por trás do carro no momento em que outro animal quebrou o plástico da lanterna traseira com uma marrada.
Um terceiro atacou a traseira do carro. King subiu no estepe quando o animal atacou o pára-choque. O impacto o derrubou. Ele rolou no chão, com os búfalos
bufando em volta. Levantou e correu para o outro lado da estrada, onde havia uma pequena elevação que ele subiu, entrando na selva. Os animais não o perseguiram.
Não que isso adiantasse muito - agora ele estava no lado errado da estrada!
Tinha de voltar para o lado certo.
Subiu até o topo da elevação e começou a descer, praguejando. Resolveu seguir naquela direção por uns cem metros, até ultrapassar o local em que estava o
bando e voltar para a estrada. Se conseguisse fazer isso, chegaria ao barco.
Quase imediatamente a mata se fechou em volta dele. Tropeçou, rolou por uma encosta de lama e quando se levantou não sabia mais para que lado ir. Estava no
fundo da ravina, as palmeiras , tinham três metros de altura e as copas eram muito fechadas. Não avistava mais de alguns metros em todas as direções. Num momento
de pânico, compreendeu que estava perdido. Seguiu em frente, abrindo a folhagem, esperando logo poder se orientar.
Os meninos estavam ainda olhando os raptores que saíam da clareira. Thorne levou Levine para um lado e disse em voz baixa.
- Por que você quis que viéssemos para cá?
- Apenas precaução. Levar o filhote para o trailer foi o mesmo que pedir encrenca.
- Que tipo de encrenca? Levine deu de ombros.
- Nós não sabemos, esse é o caso. Mas de um modo geral, os pais não gostam que levem seus filhos. E aquele filhote tem pais bem grandes.
Do outro lado do abrigo, Arby exclamou.
- Vejam! Vejam!
- O que é? - perguntou Levine.
- Um homem.
Ofegante, King saiu da selva para a planície. Finalmente via onde
estava. Parou, com a roupa molhada e suja de lama, para se orientar.
Desapontado, viu que não estava perto do barco. Na verdade,
parecia estar ainda no lado errado da estrada. A sua frente estava uma vasta planície com um rio no meio. A planície estava deserta, a não ser por alguns
dinossauros ao longe, perto da margem do rio. Eram tricerátops, com chifres, e pareciam um pouco agitados. Os adultos, enormes, balançavam as cabeças para cima e
para baixo, emitindo sons que pareciam latidos.
Evidentemente ele devia seguir o rio até chegar ao barco. Mas precisava ter cuidado ao passar pelos tricerátops. Tirou uma barra de chocolate do bolso e desembrulhou,
enquanto observava os dinossauros, desejando que eles se fossem dali. Quanto tempo ia precisar para chegar ao barco? Era a única idéia em sua mente. Resolveu ir
em frente, com tricerátops ou não, e começou a andar entre a relva alta.
Então ouviu um silvo como de um réptil, vindo de algum ponto da relva à sua esquerda. Sentiu um cheiro de podre. King parou, esperando. Já não sentia o sabor
da barra de chocolate.
King ouviu às suas costas o ruído de alguma coisa mergulhando na água. Vinha do rio.
King se voltou para ver.
- E um dos homens do jipe - Arby disse, olhando lá de cima. - Mas, o que ele está esperando?
De onde estavam viam os vultos escuros dos raptores entre a relva no outro lado do rio. Dois deles se adiantaram e entraram na água. Estavam indo na direção
do homem.
- Oh, não - disse Arby.
King viu dois lagartos escuros e listrados atravessando o rio. Andavam apoiados nas patas traseiras, em pequenos saltos. Os corpos refletiam-se na água do
rio. Abriam e fechavam as mandí-bulas e silvavam ameaçadoramente.
Ele olhou para a parte alta do rio e viu outro lagarto na água e outro mais atrás. Os animais mergulharam e começaram a nadar.
Howard King recuou, afastando-se do rio, voltando para a relva alta. Depois deu me ia-volta e correu. Com a relva na altura do peito ele corria, respirando
com dificuldade, quando a cabeça de outro lagarto apareceu na sua frente, sibilando e rosnando. King desviou, mudou de direção, mas outro lagarto saltou no ar, tão
alto que todo o seu corpo ficou acima da relva e King viu o animal inteiro voando na sua direção, as duas pernas erguidas para o ataque. King viu rapidamente as
garras curvas e afiadas como punhais.
Ele girou o corpo outra vez e o lagarto soltou um grito agudo, caindo no chão atrás dele e se afastou entre a relva. King continuou a correr, energizado por
puro medo. Ouviu o lagarto rosnar atrás dele. Correu depressa. Viu à frente mais uns vinte metros de clareira e depois a selva. Viu as árvores - grandes. Podia subir
numa delas e escapar dos animais.
A esquerda King viu outro lagarto, movendo-se na diagonal, ná sua direção. Só via a cabeça acima da relva. O lagarto parecia se mover com uma rapidez incrível.
King pensou: Não vou conseguir.
Mas ia tentar.
Ofegante, com os pulmões em fogo, ele correu para as árvores. Só mais uns dez metros agora. Seus braços eram como bombas, suas pernas como rodas, a respiração
entrecortada.
Então, uma coisa pesada o atingiu nas costas, jogando-o ao chão. King sentiu uma dor aguda nas costas e sabia que as garras do animal tinham rasgado sua carne
quando o derrubou. A queda foi violenta e ele tentou rolar, mas o animal o segurou. King não podia se mover. Estava de bruços preso ao chão, ouvindo o rosnado do
animal nas suas costas. A dor era tremenda, agonizante.
Então sentiu na nuca o hálito quente do animal e ouviu a respiração áspera. Seu terror era extremo. De repente, foi dominado por uma espécie de lassidão,
uma sonolência abençoada. Tudo ficou em câmara lenta. Como num sonho, ele via as hastes de relva na frente do rosto. Ele as via com uma espécie de lânguida intensidade
e quase não se importava com a dor no pescoço, quase não se importava com o fato de o seu pescoço estar entre as mandíbulas quentes do animal. Tudo parecia estar
acontecendo a outra pessoa. King estava a quilômetros dali. Teve um momento de surpresa quando sentiu partir os ossos do pescoço, com um estalo e um som de coisa
amassada...
E, então, só trevas.
Nada.

- Não olhem - Thorne disse, virando Arby de costas para a planície lá embaixo. Puxou o menino para ele, mas Arby, impaciente, o empurrou e virou outra vez,
para ver o que estava acontecendo. Thorne estendeu o braço para Kelly mas ela se afastou e continuou a olhar para a planície.
- Não olhem - Thorne repetia. - Não olhem.
Os meninos olhavam em silêncio.
Levine observava a cena com o binóculo. Agora eram cinco raptores rosnando em cima do corpo do homem, arrancando furiosamente a carne da carcaça. Um dos raptores
ergueu a cabeça num gesto brusco, rasgando um pedaço da camisa cheia de sangue, um pedaço do colarinho. Outro sacudiu a cabeça do homem entre os dentes antes de
jogá-la no chão. O trovão rolou na planície e o relâmpago cortou o céu distante. Começava a escurecer e Levine não via claramente o que estava acontecendo. Mas era
evidente que, fosse qual fosse a organização hierárquica que eles usavam para caçar, naquele momento foi abandonada.
Ali, era cada um por si. Os raptores frenéticos saltavam e abaixavam a cabeça, tirando pedaços de carne do corpo do homem. Levine notou muita disputa e muita
briga entre os animais. Um deles levantou o corpo com uma coisa marrom pendurada no canto da boca, mastigando com uma expressão estranha. Então, ele se afastou do
grupo e segurou o objeto cuidadosamente na curva das patas dianteiras. Com a pouca luz, só depois de algum tempo, Levine reconheceu o que ele estava fazendo. O dinossauro
estava comendo uma barra de chocolate. E parecia estar gostando.
O raptor voltou para o meio do grupo e mergulhou o focinho na carcaça outra vez. No outro lado da planície, outros raptores se apressavam para partilhar o
banquete, meio correndo, meio saltando. Rosnando e furiosos, atiraram-se avidamente no meio do grupo.
Levine abaixou o binóculo e olhou para os meninos. Eles assistiam calma e silenciosamente à carnificina.

DODGSON


Dodgson foi acordado por um vozerio agitado, como o chilreio de centenas de pássaros. Parecia vir de todos os lados. Aos poucos ele percebeu que estava deitado
de costas no chão úmido e em declive. Tentou se mover, mas seu corpo estava todo dolorido e muito pesado. Havia alguma coisa sobre suas pernas, sua barriga, seus
braços. O peso no peito dificultava a respiração.
E estava com sono, com um sono incrível. Tudo o que ele desejava naquele momento era voltar a dormir. Começou a deslizar para a inconsciência novamente, mas
alguma coisa estava puxando seus dedos, um por um. Como para trazê-lo de volta. Lentamente, muito lentamente, obrigando-o a recuperar a consciência.
Dodgson abriu os olhos.
Um pequeno dinossauro verde estava ao lado da sua mão. O animal se inclinou para a frente, mordeu o dedo de Dodgson com as pequenas mandíbulas e puxou a carne.
Seus dedos sangravam. O animal já havia tirado vários pedaços de carne.
Dodgson puxou a mão, surpreso e o chilreio ficou mais alto. Virou a cabeça e viu que estava cercado por pequenos dinossauros verdes, uns no seu peito, outros
nas pernas. Tinham o tamanho de galinhas e bicavam como galinhas, com movimentos rápidos da cabeça, tirando pedaços de carne da sua barriga, dos quadris, da virilha.
Alarmado, Dodgson levantou com um salto, espalhando os pequenos lagartos por todos os lados. Eles saltaram para longe, chilreando zangados. Deram alguns passos
e pararam. Viraram a cabeça e olharam para ele sem o menor sinal de medo. Ao contrário, estavam esperando.
Só então Dodgson compreendeu o que efes efam, Eram Procompsognathus. Comps.
Animais necrófagos.
Cristo, ele pensou. Eles pensaram que eu estava morto.
Dodgson cambaleou para trás, quase perdendo o equilíbrio. Sentiu dor e uma onda de tontura. Os animais chilreavam, observando seus movimentos.
- Vão embora. - Ele agitou as mãos. - Saiam daqui.
Eles não saíram. Ficaram ali parados, com a cabeça inclinada para o lado, curiosos, olhando para ele, esperando.
Dodgson olhou para baixo. Sua camisa, sua calça estavam rasgadas em centenas de lugares. O sangue pingava dos pequenos ferimentos. Sentiu outra vez uma tontura
e dobrou o corpo, com as mãos nos joelhos. Respirou fundo e viu o sangue pingar nas folhas que cobriam o chão.
Cristo, ele pensou. Respirou profundamente outra vez.
Vendo que ele não se movia, os animais começaram a avançar lentamente. Ele endireitou o corpo e eles recuaram. Mas logo depois, começaram a avançar outra
vez.
Um chegou perto. Dodgson o mandou pelos ares com um violento pontapé. O animal gritou assustado, mas caiu como um gato, de pé e intacto.
Os outros ficaram onde estavam.
Esperando.

Dodgson viu que começava a escurecer. Seu relógio marcava 6:40. Só mais alguns minutos de luz do dia. Sob as árvores já estava escuro.
Precisava ir para um lugar seguro, imediatamente. Consultou a bússola presa à correia do relógio e seguiu para o sul. Tinha certeza de que o rio ficava ao
sul. Precisava voltar para o barco. No barco estaria seguro.
Assim que ele começou a andar, os comps chilrearam outra vez e saíram atrás, mantendo uma distância de dois ou três metros, fazendo um barulho infernal, tagarelando
o tempo todo, saltando, abrindo caminho entre a folhagem. Havia dezenas deles. Quando a noite chegou, seus olhos verdes brilhavam no escuro.
Todo o seu corpo era uma massa de dor. Cada passo era um sofrimento. Tinha dificuldade de manter o equilíbrio. Estava perdendo sangue e a vontade de dormir
era imperiosa. Jamais chegaria ao rio. Não ia agüentar mais que uns duzentos metros. Tropeçou numa raiz e caiu. Levantou lentamente com terra grudada na roupa cheia
de sangue.
Olhou para trás, para os olhos verdes, e redobrou o esforço para seguir andando. Podia andar mais um pouco, pensou. Então, bem na frente, viu uma luz através
da folhagem. Seria o barco? Dodgson apressou o passo, sempre ouvindo os comps atrás dele.
Afastou a folhagem e viu uma pequena construção de concreto, um depósito de ferramentas ou uma casa da guarda com telhado de zinco. A luz brilhava na janela
quadrada. Ele caiu outra vez, levantou e se arrastou o resto da distância até a casa. Segurou na maçaneta para se levantar e abriu a porta.
A pequena casa estava vazia. Alguns canos atravessavam o chão. Deviam estar ligados a máquinas, mas agora não havia nenhuma, só as marcas de ferrugem nos
lugares em tinham estado presas ao chão de concreto. Olhou pela janela e viu os comps lá fora, batendo nos vidros sujos, pulando, frustrados. Mas naquele momento
ele estava a salvo.
É claro que teria de continuar. Precisava sair daquela ilha desgraçada. Mas não agora, pensou.
Mais tarde. Mais tarde pensaria em tudo isso.
Dodgson encostou o rosto no chão úmido e adormeceu.

O TRAILER


Sarah Harding envolveu a perna do filhote com a armação de folha de alumínio. O animal estava ainda inconsciente, respirando normalmente, imóvel, o corpo
relaxado. O oxigênio zumbia.
Ela moldou a folha de alumínio como uma bainha de seis polegadas de comprimento. Com um pequeno pincel, começou a passar a resina para fazer o "gesso".
- Quantos raptores nós vimos? - ela perguntou. - Não tive tempo de contar. Calculei uns nove.
- Acho que há mais - disse Malcolm. - Uns onze ou doze ao todo.
- Doze? - Sarah olhou para ele. - Nesta ilha tão pequena?
- Sim.
A resina tinha um cheiro forte, como cola. Ela continuou a pincelar o alumínio.
- Sabe o que estou pensando? - Sarah disse.
- Sei. Um número muito grande.
- Grande demais, Ian. - Ela continuou com o trabalho. - Não faz sentido. Na África, predadores ativos, como os leões, estão muito espalhados. Um leão para
dez quilômetros quadrados. As vezes até quinze quilômetros. E tudo o que a ecologia pode comportar. Numa ilha como esta, não deveria haver mais do que cinco raptores.
Segure isto.
- Hum, hum. Mas não esqueça que aqui a presa é enorme... Alguns desses animais pesam vinte ou trinta toneladas.
- Não estou certa de que isso seja um fator - disse Sarah. - Mas digamos que seja. Eu dobro a estimativa e concedo dez raptores para a ilha. Mas você me diz
que são doze. E há outros predadores importantes também. Como os rex...
- Sim, tem razão.
- E demais. - Sarah balançou a cabeça.
- A população animal é muito densa aqui - disse Malcolm.
- Não o suficiente - insistiu ela. - Em geral, os estudos dos predadores - sejam tigres da índia ou leões da África - parecem demonstrar que é possível haver
um predador para cada duzentas presas. Isso significa que para comportar doze predadores aqui, seriam necessários pelo menos cinco mil presas em toda a ilha. Acha
que tem tudo isso?
- Não.
- Quantos animais você calcula, ao todo? Ele deu de ombros.
- Algumas centenas. Quinhentos no máximo.
- Então você está fora, por ordem de magnitude, Ian. Segure isto que vou apanhar a lâmpada.
Ela suspendeu a lâmpada sobre o filhote para endurecer a resina e ajustou a máscara de oxigênio.
- A ilha não pode comportar todos esses predadores - Sarah disse. - Mas eles estão aqui.
- O que poderia explicar isso? Sarah balançou a cabeça.
- Deve haver uma fonte de alimento que desconhecemos.
- Quer dizer, uma fonte artificial. Não acho que haja.
- Não. Fontes artificiais de alimento fazem com que os animais fiquem mansos. E esses animais não são mansos. Só posso pensar em uma única possibilidade.
Um diferencial no índice de mortes entre as presas. Se eles crescem muito depressa ou morrem jovens, então isso pode representar uma fonte de alimento maior do que
se pode esperar.
- Eu notei - disse Malcolm - que os animais adultos parecem pequenos. É como se não chegassem à maturidade. Talvez sejam mortos muito cedo.
- Pode ser. Mas se houver um diferencial no índice de mortes suficiente para manter esta população, veríamos a prova em carcaças e esqueletos de mamíferos
mortos. Viu alguma coisa assim?
Malcolm balançou a cabeça.
- Não, na verdade, agora que você mencionou, não vi nenhum esqueleto.
- Eu também não. - Ela afastou a lâmpada. - Há alguma coisa estranha nesta ilha, Ian.
xyxy
- Eu sei.
- Você sabe?
- Sei. Suspeitei desde o começo.

O trovão rolou no vale. Do alto, no abrigo, viam a planície silenciosa a não ser pelos rosnados distantes dos raptores.
- Talvez seja melhor voltarmos - Eddie disse, inquieto.
- Por quê? - Levine estava satisfeito por ter lembrado de levar os óculos de visão noturna. Com eles via o mundo em tons de verde-claro. Via os raptores
no local da caça, a relva amassada e vermelha de sangue. Há muito tempo tinham terminado de devorar a carcaça, mas ouvia-se ainda o ruído dos ossos mastigados.
- Eu acho - disse Eddie - que à noite estaremos mais seguros no trailer.
- Por quê? - repetiu Levine.
- Bem, o trailer é reforçado e muito seguro. Tem tudo do que precisamos. Acho que devíamos estar lá. Não está pensando em passar a noite aqui, está?
- Não - disse Levine. - O que pensa que sou, um fanático? Eddie apenas resmungou.
- Mas vamos ficar mais um pouco aqui - sugeriu Levine.
- Thorne? - disse Eddie. - O que acha? Logo vai começar a chover.
- Só mais um pouco - respondeu Thorne. - Depois, voltamos todos juntos.

- Os dinossauros estão nesta ilha há cinco anos ou talvez mais - disse Malcolm - mas nenhum apareceu em outro lugar qualquer. Então, de repente, no ano passado,
começaram a aparecer carcaças de dinossauros nas praias da Costa Rica e, segundo os relatórios, em algumas ilhas do Pacífico também.
- Levadas pelas correntes?
- Supostamente. Mas a questão é por que agora? Por que, de uma hora para outra, depois de cinco anos? Alguma coisa mudou, mas não sabemos... Espere um pouco.
- Foi até o console do computador e olhou para a tela.
- O que está fazendo? - Sarah perguntou.
- Arby entrou na antiga rede da ilha que tinha ainda arquivos de pesquisa da década de 1980. - Malcolm moveu o mouse. -Nós não os examinamos. - O menu apareceu,
mostrando arquivos de trabalho e arquivos de pesquisa. Malcolm começou a passar alguns textos na tela. Anos atrás eles tiveram problemas com uma doença - ele disse.
- Havia uma porção de anotações a respeito no laboratório.
- Que tipo de doença?
- Eles não sabiam.
- Na selva existem várias doenças de ação muito lenta - Sarah disse. - Podem levar cinco ou dez anos para se manifestar. Provocadas por vírus ou príons.
- Mas - observou Malcolm - essas doenças são causadas por alimento contaminado.
Depois de um breve silêncio, Sarah perguntou:
- Com o que você acha que eles alimentavam os animais, naquele tempo? Porque se eu tivesse de criar um filhote de dinossauro, não saberia o que dar a ele.
O que eles comem? Tomam leite, eu suponho, mas...
- Leite, sim - Malcolm disse, lendo o texto na tela - Nas primeiras seis semanas, leite de cabra.
- É a escolha lógica - observou Sarah. - É o que sempre usam nos zoológicos porque o leite de cabra é hipoalergênico. E mais tarde?
- Deixe-me examinar isto por um minuto.
Sarah estava segurando a perna do filhote, esperando a resina secar. Ela cheirou o molde. O cheiro era ainda muito forte.
- Espero que isto dê certo - ela disse. - Às vezes, por causa de algum cheiro diferente, os animais rejeitam os filhotes. Mas talvez este cheiro desapareça
quando a resina estiver seca. Quanto tempo faz?
Malcolm consultou o relógio.
- Dez minutos. Mais dez e estará seca.
- Eu gostaria de levar este cara de volta ao ninho. Ouviram o trovão e olharam para a noite negra lá fora.
- Acho que é tarde demais para levá-lo esta noite - disse Malcolm, sem parar de digitar no teclado do computador. - Então... com o que eles os alimentavam?
Muito bem. De 1988 a 1989... os herbívoros comiam uma papa de plantas três vezes ao dia... e os carnívoros...
Ele parou.
- O que os carnívoros comiam?
- Parece um extrato moído de proteína animal...
- De quê? A fonte comum é peru ou galinha, com adição de alguns antibióticos.
- Sarah - disse Malcolm. - Eles usavam extrato de proteína de ovelhas.
- Não. Não fariam isso.
- Sim, faziam. Compravam de um fornecedor.
- Está brincando - disse ela.
- Não, não estou. Agora, deixe ver se descubro...
Um alarme discreto soou no trailer. No painel acima do computador uma luz vermelha começou a piscar. Um instante depois, as luzes externas da capota acenderam
inundando a clareira com seu brilho halógeno.
- O que é isso? - perguntou Sarah.
- O sensor, alguma coisa o ativou. - Malcolm levantou e foi até a janela. Viu apenas a relva alta e as árvores escuras no fim da clareira. Tudo estava silencioso
e imóvel.
Sarah, ainda atenta ao filhote, perguntou:
- O que aconteceu?
- Eu não sei. Não vejo nada.
- Mas alguma coisa ativou o sensor.
- Acho que sim.
- O vento?
- Não há vento - disse Malcolm.
No abrigo Kelly exclamou:
- Ei, vejam!
Thorne olhou. Lá de cima eles viam ao norte o penhasco alto atrás deles e os dois trailers mais acima, na clareira com a relva alta. As luzes externas do
trailer estavam acesas. Thorne apanhou o rádio do cinto.
- Ian? Está me ouvindo?
Um pouco de estática e então a voz de Malcolm:
- Estou aqui, Thorne.
- O que está acontecendo?
- Eu não sei. As luzes do perímetro simplesmente acenderam. Acho que o sensor foi ativado. Mas não estamos vendo nada lá fora.
- O ar está esfriando rapidamente - Eddie disse. - Talvez a convecção das correntes tenha ativado o sensor.
- Ian? - disse Thorne. - Está tudo bem?
- Sim. Muito bem. Não se preocupe.
- Sempre achei que ajustamos a sensor para uma sensibilidade muito alta - disse Eddie. - É isso.
Levine franziu a testa e não disse nada.

Depois de terminar o tratamento da perna quebrada, Sarah envolveu o filhote num cobertor e o prendeu à mesa com tiras de pano. Então foi para o lado de Malcolm
na janela.
- O que você acha? Malcolm deu de ombros.
- Eddie diz que o sistema é muito sensível.
- E mesmo?
- Eu não sei. Nunca foi testado. - Olhou para as árvores no fim da clareira, procurando algum movimento. Então teve a impressão de ouvir algo que parecia
um rosnado, respondido de algum lugar atrás deles. Foi para a janela do outro lado e olhou para as árvores.
Malcolm e Harding olhavam para fora, tentando ver alguma coisa dentro da noite. Malcolm estava tenso. Depois de um momento, Sarah disse:
- Não vejo nada, Ian.
- Eu também não.
- Deve ter sido um alarme falso.
Então ele sentiu a vibração, um som surdo que fez tremer o chão do trailer. Malcolm olhou para Sarah, assustado.
Ele sabia o que era. O assoalho vibrou outra vez, com maior intensidade.
Sarah olhou pela janela e murmurou:
- Ian, estou vendo.
Malcolm olhou também. Sarah apontou para as árvores mais próximas.
- O quê?
Então ele viu a cabeça enorme aparecer entre a folhagem, alcançando a metade da altura de uma árvore. A cabeça virou de um lado para o outro, como que escutando.
Era um tiranossauro rex adulto.
- Ian - ela murmurou. - Veja, são dois.
A direita, ele viu o segundo animal saindo do meio das árvores. Era maior que o primeiro, a fêmea do par. Os animais rosnaram e o som rolou no ar da noite.
Lentamente eles saíram da mata para a clareira, piscando por causa da luz forte.
- Esses são os pais?
- Eu não sei. Acho que são.
Malcolm olhou para o filhote, ainda inconsciente, a respiração regular levantando e abaixando o cobertor.
- O que estão fazendo aqui? - ela perguntou.
- Eu não sei.
Os animais estavam ainda parados na entrada da clareira perto das árvores. Pareciam hesitar, esperando.
- Estão procurando o filhote? - Sarah perguntou.
- Sarah, por favor.
- Falo sério.
- Isso é ridículo.
- Por quê? Eles devem ter seguido a pista até aqui. Levantando as cabeças, os animais as giraram de um lado para
o outro lentamente. Repetiram o movimento e deram um passo paia a frente, na direção do trailer.
- Sarah, estamos a quilômetros do ninho. Eles não poderiam ter seguido nenhuma pista até aqui.
- Como você sabe?
- Sarah...
- Você mesmo disse que não sabemos coisa alguma sobre esses animais. Não sabemos nada da sua fisiologia, sua bioquímica, seu sistema nervoso, seu comportamento.
E não sabemos coisa alguma sobre seus sentidos.
- Sim, mas...
- Eles são predadores, Ian. Visão, audição e olfato aguçados.
- Suponho que sim. Sim.
- Mas não sabemos que mais.
- Que mais?
- Ian. Existem outras modalidades de sentidos. As serpentes sentem o infravermelho. Os morcegos possuem ecolocalização. Os pássaros e as tartarugas têm sensores
magnéticos - podem detectar o campo magnético da Terra e é assim que elas migram. Os dinossauros podem ter outras modalidades de sentidos que nem imaginamos.
- Sarah, isso é ridículo.
- É mesmo? Então me diga, o que eles estão fazendo aqui? Lá fora, perto das árvores, os tiranossauros estavam em
silêncio. Já não rosnavam, mas continuavam a balançar a cabeça em arcos lentos, virando para a esquerda e para a direita. Malcolm pensou por um momento.
- Parece que... estão olhando em volta...
- Olhando diretamente para as luzes fortes? Não, Ian. Estão cegos.
Malcolm percebeu que ela estava certa. Mas aquele movimento constante da cabeça...
- Então, o que estão fazendo? Farejando?
- Não. As cabeças estão levantadas. As narinas não se movem.
- Escutando?
- É possível.
- Escutando o quê?
- Talvez tentando ouvir o filhote.
Malcolm olhou para o animalzinho sobre a mesa.
- Sarah, o filhote está inconsciente.
- Eu sei.
- Não está fazendo nenhum ruído.
- Nenhum que possamos ouvir. - Ela olhou para os tiranossauros. - Mas eles estão fazendo alguma coisa, lan. Esse comportamento tem um significado. Só que
não sabemos qual é.

No posto de observação, Levine olhava para a clareira com os óculos de visão noturna. Viu dois tiranossauros na entrada da floresta, balançando as cabeças
num movimento estranho, sincronizado.
Os animais deram alguns passos hesitantes na direção do trailer, levantaram as cabeças, viraram para a esquerda e para a direita e finalmente pareceram tomar
uma decisão e começaram a avançar rápida e quase agressivamente atravessando a clareira.
Ouviram a voz de Malcolm no rádio.
- São as luzes! Estão sendo atraídos pelas luzes.
Logo depois as luzes externas do trailer apagaram. Todos se esforçavam para ver na clareira escura. Ouviram Malcolm dizer:
- Deu certo.
Thorne disse para Levine.
- O que está vendo?
- Nada.
- O que eles estão fazendo?
- Estão parados.
Com os óculos de visão noturna Levine via os tiranossauros parados, aparentemente confusos pela mudança na luz. Mesmo à distância ele os ouvia rosnar, mas
ainda hesitantes. Balançavam a cabeça para cima e para baixo e abriam e fechavam a boca. Mas não se aproximaram do trailer.
- O que está acontecendo? - Kelly perguntou.
- Estão esperando - respondeu Levine. - Pelo menos por enquanto.
Levine tinha a impressão exata de que os tiranossauros estavam perturbados. O trailer devia representar uma mudança assustadora no seu meio ambiente. Talvez
desistissem e voltassem para n Nelva, ele pensou. A despeito do tamanho enorme, eram animais cnutelosos, quase tímidos.
Eles rosnaram outra vez. E então Levine os viu caminhar para a frente, para o trailer escuro.
- Ian, o que vamos fazer?
- Não tenho idéia - murmurou Malcolm.
Estavam agachados no centro do trailer para não serem vistos pelas janelas. Os tiranossauros continuaram sua marcha implacável para o trailer. Sentiam o chão
vibrar a cada passo - dois animais de dez toneladas caminhando em direção a eles.
- Estão vindo direto para nós!
- Sim, já notei - disse Malcolm.
O primeiro animal chegou tão perto do trailer que o corpo enorme bloqueou toda a janela. Tudo o que Malcolm via eram as pernas musculosas e a barriga. A cabeça
estava muito acima do alcance da sua visão.
Então o segundo tiranossauro chegou do outro lado. Os animais começaram a andar em volta do trailer, rosnando e bufando. O chão tremia debaixo deles. Exalavam
o cheiro forte do predador. Um deles se encostou de repente na lateral do trailer e eles ouviram o som raspante da pele dura no metal.
Por um breve momento, Malcolm sentiu pânico. Foi o cheiro, o cheiro que, de repente, o fez lembrar de outra vez, no passado. Começou a suar. Olhou para Sarah
e viu que ela observava atentamente os movimentos dos animais.
- Este não é um comportamento de caçador - ela murmurou.
- Eu não sei. Talvez seja. Não são leões, você sabe.
Um dos tiranossauros soltou um urro e o som assustador encheu a noite.
- Não estão caçando - Sarah disse. - Estão procurando, Ian. Logo em seguida, o segundo tiranossauro soltou um urro, em
resposta. Então a cabeça enorme abaixou e olhou pela janela na frente deles. Malcolm deitou rapidamente no chão do trailer e Sarah caiu por cima, sua bota
apertando a orelha dele.
- Tudo vai dar certo, Sarah...
Lá fora, os tiranossauros bufavam e rosnavam.
Malcolm disse em voz baixa:
- Será que pode se mover para o lado?
Sarah rolou para o lado e Malcolm levantou um pouco o corpo, espiando cautelosamente por cima da almofada do sofá. O olho enorme do rex virou para ele, depois
girou na órbita. Malcolm viu as mandíbulas abrindo e fechando. O hálito quente do animal embaçou o vidro.
O tiranossauro levou a cabeça para trás, afastando-a do trailer e por um momento a respiração de Malcolm voltou ao normal. Mas a cabeça foi para a frente
outra vez e bateu com baque surdo, balançando o trailer.
- Não se preocupe, Sarah. Os trailers são muito resistentes.
- Nem imagina que alívio é para mim saber disso - ela murmurou.
No outro lado, o outro rex urrou e atacou o trailer com o focinho. A suspensão estalou com o impacto.
Os dois dinossauros começaram a golpear o trailer em movimentos alternados, um de cada lado. Malcolm e Sarah eram atirados de um lado para o outro. Sarah
tentou se firmar, mas o impacto seguinte a atirou longe. O chão se inclinava loucamente a cada golpe. O equipamento do laboratório voou da mesa. Vidros se partiam.
Então, de repente, tudo parou.
Gemendo, Malcolm levantou apoiado num joelho e espiou pela janela. Viu o flanco de um dos animais movendo-se para a frente.
- O que fazemos agora? - ele perguntou em voz baixa. Thorne disse no rádio.
- Ian, está me ouvindo? Ian?
- Pelo amor de Deus, desligue essa coisa - Sarah murmurou. Malcolm apanhou o rádio do cinto e disse em voz baixa:
- Estamos bem. - E desligou.
Sem se levantar, apoiando-se nas mãos e nos joelhos, Sarah seguiu para o laboratório de biologia. Malcolm foi atrás e viu o tiranossauro espiando pela janela,
olhando para o filhote amarrado na mesa. O animal soltou um grunhido rouco.
Parou, sempre olhando pela janela, e grunhiu outra vez.
- Ela quer o filho - Sarah murmurou.
- Bem, Deus sabe que por mim ela pode levar - disse Malcolm, os dois agachados, tentando ficar fora do alcance do olho do animal.
- Como vamos entregar o filhote para ela?
- Eu não sei. Talvez abrir a porta e jogá-lo para fora. o - Não quero que seja pisado por eles - disse Sarah.
- Quem se importa ? - resmungou Malcolm.
O tiranossauro na janela soltou uma série de grunhidos baixos, seguidos por um rosnado longo e ameaçador. Era a fêmea, o maior dos dois.
- Sarah...
Mas ela já estava de pé, olhando para o tiranossauro, e começou a falar com voz suave e calma.
- Está tudo bem... Está tudo bem agora... O bebê está bem... Só vou soltar estas tiras... Pode olhar...
A cabeça era tão grande que enchia toda a janela. Sarah via os músculos fortes do pescoço movimentando-se sob a pele. As mandíbulas abriram e fecharam um
pouco. Com mãos trêmulas, ela desatou as tiras de pano.
- Está tudo bem... Seu bebê está bem... Veja, ele está bem... Agachado ao lado dela, Malcolm perguntou em voz baixa:
- O que você está fazendo?
Sem mudar o tom de voz, Sarah disse:
- Sei que parece loucura... Mas funciona com leões... Às vezes... Pronto... Seu bebê está livre...
Sarah tirou o cobertor e a máscara de oxigênio do filhote, sempre falando calmamente.
- Agora... tudo o que tenho a fazer... - Ergueu o filhote com as duas mãos - .. é entregar para você...
De repente a fêmea jogou a cabeça para trás e bateu com o lado dela no vidro que se estilhaçou com um estalo seco, formando uma teia. Sarah não podia ver
o animal lá fora mas viu a sombra se movendo e o segundo golpe arrancou o vidro do caixilho. O filhote escapou das mãos de Sarah, caindo na bandeja de aço e ela
saltou para trás quando a cabeça do tiranossauro entrou pela janela, chegando quase até a metade do trailer. O sangue escorria do focinho do animal cortado pelos
vidros. Mas depois desse primeiro ataque, toda a violência desapareceu e os movimentos do tiranossauro enorme eram agora quase delicados. O animal cheirou o filhote,
começando na cabeça e descendo até a perna. Farejou e lambeu o molde com a ponta da língua. Finalmente apoiou a mandíbula inferior gentilmente no peito do filhote
e ficou assim por um longo tempo, imóvel. Só os olhos piscavam devagar, fixos em Sarah.
Malcolm, deitado no chão, viu o sangue pingar da mesa. Começou a se levantar, mas Sarah empurrou a cabeça dele para baixo.
- Sshh - ela murmurou.
- O que está acontecendo?
- Ela está sentindo o coração do filhote.
O tiranossauro rosnou, abriu a boca e gentilmente apanhou o filhote entre os dentes. Depois recuou devagar, passando com cuidado pelo vidro quebrado e levou
o filhote para fora do trailer.
Então, pôs o filhote no chão, onde Sarah e Malcolm não podiam ver, e inclinou a cabeça sobre ele, desaparecendo também.
Malcolm murmurou.
- Ele acordou? O filhote acordou?
- Sshh!
O som que ouviam agora era o de um animal tomando água, intercalado com rosnados baixos e guturais. Malcolm viu Sarah se inclinar para fora da janela, tentando
ver, e disse, sempre em voz baixa:
- O que está acontecendo?
- Ela está lambendo o filhote. E empurrando-o com o focinho.
- E que mais?
- Só isso.
- E o filhote?
- Nada. Ele rola de um lado para o outro, como se estivesse morto. Quanta morfina você deu a ele na última vez?
- Não sei. Como vou saber?
Deitado no chão, Malcolm ouvia o ruído das lambidas e os rosnados surdos. Finalmente, depois do que pareceu uma eternidade, ouviu um ganido fino e fraco.
- Ele está acordando, Ian! O filhote está acordando! Malcolm ficou de joelhos e olhou pela janela. Viu o tiranossauro carregando o filhote na boca, afastando-se
do trailer na direção da floresta.

- O que ele está fazendo?
- Acho que vai levá-lo de volta.
Então o segundo adulto apareceu, andando atrás do primeiro. Malcolm e Sarah viram os animais afastando-se do trailer. Malcolm relaxou o corpo.
- Essa foi por pouco - ele disse.
- Sim. Foi por pouco. - Sarah suspirou, limpando o sangue do braço.

No posto de observação, Thorne ligou o rádio.
- Ian! Está me ouvindo? Ian!
- Talvez ele tenha desligado o rádio - Kelly sugeriu. Uma chuva fraca começou a cair, batendo no telhado de metal
do abrigo. Levine observava o penhasco com os óculos de visão noturna. Um relâmpago riscou o céu e Thorne perguntou.
- Dá para ver o que os animais estão fazendo?
- Eu estou vendo - Eddie disse. - Parece... parece que estão indo embora.
A alegria foi geral.
Só Levine continuou em silêncio, observando com seus óculos.
- E isso mesmo, Richard? Está tudo bem?
- Francamente, acho que não - Levine disse. - Acho que cometemos um erro muito grave.

Pela janela quebrada Malcolm viu os dois tiranossauros afastando-se do trailer. Ao lado dele, Sarah também observava em silêncio, sem tirar os olhos dos animais.
Começou a chover e a água pingava das pontas de vidro quebrado. O trovão soou distante e o relâmpago iluminou os animais gigantescos caminhando para a floresta.
Perto das grandes árvores, os dois adultos pararam e puseram o filhote no chão.
- Por que estão fazendo isso? - perguntou Sarah. - Eles deviam estar voltando para o ninho.
- Eu não sei. Talvez...
- Talvez o filhote esteia morto - ela disse.
Mas não. Outro relâmpago iluminou a clareira e ela viu o filhote se mexendo no chão. Ouviram os guinchos agudos dele quando um dos adultos o apanhou com os
dentes e o levou gentilmente até o galho alto de uma árvore.
- Oh, não. - Sarah balançou a cabeça. - Isso está errado, Ian. Completamente errado.
A fêmea ficou com o filhote por algum tempo, ajeitando-o no galho da árvore. Então ela virou-se, levantou a cabeça e rugiu.
O macho rugiu em resposta.
E depois disso, os dois animais dispararam pela clareira, na direção do trailer.
- Oh, meu Deus - Sarah murmurou.
- Procure se firmar, Sarah - Malcolm gritou. - Vai ser duro!

O impacto foi espantoso, atirando os dois para o outro lado do trailer. Sarah gritou, girando no ar. Malcolm bateu com a cabeça e caiu no chão, atordoado.
Debaixo dos seus pés o trailer balançou sobre a suspensão com um som agudo e metálico. Os tiranossauros rugiram e atacaram outra vez.
Malcolm ouviu Sarah gritar: "Ian! Ian!" e então o trailer virou de lado. Malcolm protegeu a cabeça quando pedaços de vidro e o equipamento do laboratório
despencaram sobre ele. Quando ergueu os olhos, viu tudo fora de lugar. A chuva caía no seu rosto entrando pela janela quebrada, agora bem acima da sua cabeça. Um
relâmpago iluminou a cabeça enorme olhando para ele e rosnando. Malcolm ouviu as garras do animal raspando o metal no lado do trailer, depois a cabeça desapareceu.
Um pouco depois ouviu os rugidos e os animais começaram a empurrar o trailer na terra.
Ele chamou: "Sarah!" e a viu atrás de onde ele estava. Nesse momento o mundo girou loucamente outra vez e o trailer virou com um ruído terrível de metal amassado.
Agora o trailer estava de cabeça para baixo e Malcolm começou a se arrastar no teto, tentando alcançar Sarah. Olhou para cima, para o equipamento do laboratório
fechado nas mesas. Líquido pingava em cima dele de vários lugares. Sentiu um ardor no ombro e ouviu o crepitar de coisa queimando. Devia ser ácido.
Em algum lugar no escuro Sarah gemia. À luz de outro relâmpago ele a viu, encolhida perto da conexão entre os dois trailers. A parte sanfonada de metal estava
torcida, o que significava que o outro trailer ainda estava de pé. Era loucura. Tudo era loucura.
Lá fora os tiranossauros rugiam e Malcolm ouviu uma explosão abafada. Estavam mordendo os pneus e Malcolm pensou, é uma pena que não tenham mordido os cabos
da bateria. Iam ter uma surpresa.
De repente os tiranossauros atacaram o trailer outra vez, fazendo-o deslizar de lado pela clareira. Assim que o trailer parou, eles atacaram novamente. O
trailer escorregou de lado.
Quando Malcolm chegou aonde Sarah estava, ela passou os braços em volta do pescoço dele.
- Ian - ela murmurou. O lado esquerdo do seu rosto estava escuro. Quando outro relâmpago iluminou a clareira, ele viu que estava coberto de sangue.
- Você está bem?
- Estou bem - ela disse, limpando o sangue do olho com as costas da mão.
- Dá para ver o que é isto?
Com outro relâmpago, Malcolm viu um pedaço grande de vidro enfiado no alto da testa dela. Ele o retirou e apertou o ferimento com a mão, contendo o jorro
de sangue. Estavam na cozinha. Malcolm estendeu o braço, apanhou um pano de prato e o segurou contra a testa dela. O pano logo ficou cheio de sangue.
- Está doendo? í - Não muito.
- Acho que não é muito grave - Malcolm disse. Lá fora, os tiranossauros rugiam na noite.
- O que eles estão fazendo? - Sarah perguntou, com voz fraca.
Os tiranossauros voltaram ao ataque. Dessa vez o movimento do trailer foi maior e mais demorado, deslizando de lado e para baixo.
Deslizando para baixo.
- Estão nos empurrando - ele disse.
- Para onde, Ian?
- Para a borda da clareira. - Outro ataque e o trailer avançou mais ainda. - Estão nos empurrando para a borda do penhasco.
O penhasco era pura rocha de cento e cinqüenta metros de altura, terminando no vale lá embaixo.
Não sobreviveriam à queda.
Sarah segurou o pano contra a testa e empurrou a mão de Malcolm.
- Faça alguma coisa - ela disse.
- Certo, está bem - ele respondeu.
Malcolm se afastou dela, procurando se firmar para o próximo impacto. Não sabia o que fazer. Não tinha a mínima idéia. O trailer estava de cabeça para baixo
e tudo era uma loucura. Seu ombro queimava e ele sentia o cheiro do ácido destruindo a camisa. Ou talvez fosse sua carne. Era fogo puro. O trailer estava escuro,
toda a força desligada, havia vidro espalhado por toda a parte e ele...
A força estava desligada.
Malcolm começou a se levantar mas o impacto o atirou de lado e ele bateu com a cabeça na geladeira. A porta abriu e caixas de leite e garrafas de vidro despencaram
em cima dele. Mas não havia luz na geladeira.
Porque toda a força estava desligada.
Deitado de costas, Malcolm olhou para a janela e viu o pé enorme de um dos tiranossauros amassando a relva. No momento em que o relâmpago acendeu no céu,
a pata se ergueu para o pontapé e o trailer moveu outra vez, escorregando com facilidade agora, com um rangido de metal e depois inclinando para baixo.
- Oh, droga - ele disse.
- Ian...
Mas era tarde demais, o trailer todo gemia num protesto metálico e então Malcolm viu a parte da frente mergulhando, escorregando para fora do penhasco. Começou
devagar, depois ganhou velocidade e o teto onde eles estavam estava caindo, tudo estava caindo. Sarah, caindo, segurou nele por um momento e os tiranossauros rugiam
em triunfo.
Estamos despencando do penhasco, ele pensou.
Sem saber o que fazer, Malcolm agarrou a porta da geladeira. A porta estava gelada, úmida e escorregadia. O trailer se inclinou para baixo e caiu. As mãos
de Malcolm começaram a escorregar e escorregar... no esmalte branco e frio e finalmente seus dedos se soltaram e ele começou a cair, para a outra extremidade do
trailer. Viu o banco do motorista correndo para ele, mas antes de chegar lá, bateu em alguma coisa no escuro, sentiu uma dor violenta e dobrou o corpo para a frente.
Então, lenta e suavemente, tudo desapareceu.
A chuva tamborilava no telhado de metal do abrigo, descendo como cortinas pelos lados da pequena casa no alto do andaime. Levine enxugou as lentes dos óculos
e os levou aos olhos outra vez, olhando para o penhasco no escuro.
- O que está vendo? O que aconteceu? - perguntou Arby.
- Não dá para ver - disse Levine.
A chuva impedia a visão. Um pouco antes eles tinham visto, com horror, os dois tiranossauros empurrando o trailer na direção do penhasco com a maior facilidade.
Levine calculou que os dois dinossauros formavam uma massa combinada de vinte toneladas e o trailer pesava apenas duas toneladas. Uma vez virado, deslizou facilmente
na relva molhada enquanto eles o empurravam com a barriga e davam pontapés com a força dos poderosos músculos das pernas.
- Por que estão fazendo isso? - Thorne perguntou.
- Eu acho - respondeu Levine - que nós mudamos sua noção de território.
- Não entendi.
- Não esqueça de com o que estamos lidando - disse Levine. - Os tiranossauros podem ter um comportamento complexo mas é quase todo instintivo. E a posse do
território é uma parte desse instinto. Os tiranossauros marcam o território e o defendem. Não é um comportamento racional - seu cérebro é pequeno, mas fazem isso
por instinto. Todo comportamento instintivo tem gatilhos que ativam o comportamento. E eu acho que, ao tirar o filhote do ninho, nós redefinimos seu território,
incluindo nele a clareira onde o filhote foi encontrado. Por isso agora eles vão defender seu território livrando-se dos trailers.
Então à luz de outro relâmpago eles viram a cena horrível. O primeiro trailer estava suspenso na borda do penhasco, de cabeça para baixo, ligado pela conexão
sanfonada ao segundo trailer que estava ainda no topo do rochedo, na clareira.
- Aquela conexão não vai agüentar - Eddie gritou. - Não por muito tempo!
Outro relâmpago mostrou os tiranossauros na clareira, meto-dicamente empurrando o segundo trailer para a borda do penhasco. Thorne disse para Eddie.
- Vou até lá.
- Vou com você - Eddie disse.
- Não! Fique com os meninos!
- Mas você precisa...
- Fique com os meninos! Não podemos deixá-los sozinhos.
- Mas Levine pode...
- Não, você fica! - Thorne já estava descendo pelo andaime molhado e escorregadio, para o Explorer lá embaixo. Olhou para cima e viu Eddie, Arby e Kelly observando
sua descida. Entrou no carro e ligou o motor. Já estava pensando na distância até a clareira. Eram cinco quilômetros, talvez mais. Mesmo indo muito depressa, levaria
sete ou oito minutos para chegar lá.
E então seria tarde demais. Jamais chegaria a tempo.
Mas tinha de tentar.

Sarah Harding ouviu um rangido rítmico e abriu os olhos.
Não tinha noção de direção no escuro. Então um relâmpago rasgou a noite e ela viu o vale, cento e cinqüenta metros abaixo. A paisagem balançava lentamente
de um lado para o outro.
Sarah estava olhando pelo pára-brisa do trailer suspenso na borda do penhasco. Já não estavam caindo, mas precariamente suspensos no espaço.
Ela estava deitada no banco da frente que, depois de se soltar do chão com o impacto, tinha batido contra um painel de controle. Sarah viu os fios soltos
e os indicadores do painel brilhando vagamente.
O sangue no olho esquerdo a impedia de enxergar com clareza. Ela rasgou duas tiras da ponta da camisa. Com a primeira fez uma compressa que aplicou ao ferimento
e amarrou a outra em volta da cabeça para segurar a compressa. Por um momento a dor foi intensa, e Sarah apertou os dentes até diminuir.
Alguma coisa vibrava acima dela. Sarah virou o corpo e olhou para cima. Viu que o trailer estava suspenso verticalmente. Malcolm estava três metros acima,
com o corpo dobrado sobre uma mesa, imóvel.
- Ian - ela chamou.
Ele não respondeu, nem se moveu.
O trailer estremeceu outra vez, rangendo sob o golpe surdo. Então Sarah compreendeu o que estava acontecendo. O primeiro trailer estava suspenso na borda
do penhasco, balançando no ar, mas ainda ligado ao segundo trailer que estava no alto, na clareira. A única coisa que segurava o primeiro trailer era a conexão em
forma de sanfona. E os tiranossauros, lá em cima, estavam empurrando o segundo trailer para fora do penhasco.
- Ian - ela chamou. - Ian.
Sarah levantou, ignorando as dores no corpo todo. Sentiu uma leve tontura e pensou que devia ter perdido muito sangue. Começou a subir. Ficou de pé no banco
e se segurou na mesa do laboratório mais próxima. Ergueu o corpo até alcançar uma alça pregada na parede. O trailer balançava no ar.
Da alça, ela conseguiu segurar na porta da geladeira, depois enfiou os dedos numa das prateleiras internas. Experimentou a resistência e apoiou nela todo
o peso do corpo. Levantou uma perna até firmar o pé na geladeira. Depois ergueu mais o corpo até ficar com este na vertical para alcançar a alça do fogão.
Era como fazer alpinismo numa maldita cozinha, ela pensou.
Logo estava ao lado de Malcolm. Outro relâmpago e ela viu o rosto dele cheio de equimoses. Ele gemeu. Sarah chegou mais perto, tentando ver a gravidade dos
ferimentos.
- Ian - ela disse.
Ele estava de olhos fechados.
- Eu sinto muito.
- Esqueça.
- Eu trouxe você para isto.
- Ian, pode se mover? Você está bem?
- Minha perna - gemeu ele.
- Ian, precisamos fazer alguma coisa.
Sarah ouviu os tiranossauros rugindo lá em cima, na clareira. Era como se tivesse ouvido aqueles rugidos durante toda a sua vida. O trailer deu um salto e
girou, sua perna escorregou da geladeira e ela ficou suspensa pela mão que segurava a porta do fogão. A outra extremidade do trailer estava uns seis metros abaixo.
Aalça do fogão não ia suportar seu peso. Não por muito tempo.
Sarah balançou as pernas vigorosamente e tocou em alguma coisa sólida. Experimentou com os pés e desceu. Olhando para trás, viu que estava de pé no lado da
pia de aço inoxidável. Fez um movimento para se firmar e a torneira abriu molhando seus pés.
Os tiranossauros rugiam e empurravam com toda a força. O trailer desceu mais um pouco, balançando no ar.
- Ian. Não temos muito tempo. Precisamos fazer alguma coisa.
Malcolm levantou a cabeça e olhou para ela. Outro relâmpago e ela viu o movimento dos lábios dele.
- A eletricidade - ele disse.
- O que tem?
- A força está desligada.
Sarah não sabia do que ele estava falando. É claro que a força estava desligada. Então lembrou. Malcolm tinha desligado a eletricidade antes do começo do
ataque. Quando os tiranossauros estavam se aproximando do trailer. A luz os tinha incomodado antes, talvez tivesse o mesmo efeito outra vez.
- Você quer que eu ligue a força?
Ele balançou a cabeça num gesto afirmativo.
- Sim, ligue.
- Como, Ian? - Sarah olhou em volta, no escuro.
- Há um painel.
- Onde?
Ele não respondeu. Sarah estendeu o braço e sacudiu o ombro dele.
- Ian, onde fica o painel? Ele apontou para baixo.
Sarah olhou e viu os fios soltos no painel.
- Não posso, está quebrado.
- Em cima...
Ela quase não o ouvia. Lembrou vagamente de que havia outro painel dentro do segundo trailer. Se ela conseguisse chegar lá, poderia ligar a força.
- Tudo bem, Ian. Vou fazer isso.
Sarah continuou a subir. O assoalho do trailer estava agora nove metros abaixo dela. Os tiranossauros rugiram e atacaram outra vez. Sarah girou no ar. E continuou.
Pretendia entrar no segundo trailer, mas quando chegou na passagem viu que não era possível. A luz do relâmpago ela viu a conexão torcida, fechada.
Estavam presos no primeiro trailer.
Ouviu os rugidos dos tiranossauros e as pancadas no segundo trailer acima da sua cabeça.
-Ian! Olhou para baixo. Malcolm estava imóvel.
Ali, suspensa no ar, Sarah sentiu que estava vencida. Outro pontapé, mais dois e tudo estaria terminado. Eles iam cair. Não podiam fazer nada. Já não tinham
tempo. Ela estava dependurada, suspensa no escuro, a força do trailer desligada e não havia nada...
Ou havia? Ouviu um leve zumbido de alguma coisa elétrica não muito longe de onde estava. Será que havia um painel naquela extremidade do trailer? Teriam instalado
dois painéis, um na frente e outro atrás?
Suspensa perto da parte de cima do trailer, com os ombros e os braços em fogo, Sarah olhou em volta procurando o segundo painel. Mas onde? Aproveitando mais
um relâmpago, olhou para um lado e para o outro.
Não viu nada.
Seus braços doíam.
- Ian, por favor...
Não havia nenhum painel.
Não era possível. Continuava a ouvir o zumbido. Tinha de haver um painel, só que ela não conseguia ver. Sarah balançou para a esquerda e para a direita e
quando outro relâmpago iluminou o trailer, desenhando sombras loucas, ela o viu finalmente.
Estava quinze centímetros acima da sua cabeça, de cabeça para baixo, mas ela podia ver os botões e interruptores, todos escuros agora. Se ela soubesse qual
deles devia usar...
Para o diabo com isso...
Soltou a mão direita e sustentando o peso do corpo só com a esquerda, começou a apertar todos os botões que alcançava. Imediatamente as luzes internas começaram
a acender.
Sarah continuou a apertar os botões, um depois do outro. Alguns entravam em curto, com pequenas centelhas e fumaça.
Ela continuou.
De repente o monitor se iluminou a poucos centímetros do seu rosto e ela viu a tela cheia de linhas sinuosas. Mas logo entrou em foco. Embora estivesse de
lado, Sarah viu os tiranossauros na clareira, com as patas da frente sobre o segundo trailer e empurrando com as pernas musculosas. Ela apertou mais botões. O último
estava protegido por uma tampa prateada. Sarah abriu a tampa e apertou esse também.
No monitor ela viu os tiranossauros desaparecendo no meio de uma explosão de fagulhas incandescentes e ouviu os rugidos de raiva. Então o monitor do vídeo
apagou, fagulhas estalaram no ar em volta dela, chamuscando seu rosto e suas mãos e tudo ficou escuro no trailer outra vez.
Por um longo momento fez-se silêncio.
Então, as pancadas recomeçaram, inexoráveis.

THORNE


Os limpadores moviam-se rapidamente no pára-brisa do Explorer. Thorne fazia as curvas velozmente, apesar da chuva. Olhou para o relógio. Dois minutos passados,
talvez três.
Talvez mais. Não tinha certeza.
A estrada era uma trilha de lama, escorregadia e perigosa. Cada vez que o carro passava por uma poça de lama, espirrando água para os lados, Thorne prendia
a respiração. O carro era à prova d'água, mas nunca se pode ter certeza com essas coisas. Cada poça era um teste. Até ali, tudo bem.
Três minutos.
No mínimo três.
Fez uma curva, a estrada se abriu à sua frente, e logo adiante ele viu uma enorme poça de água. Thorne acelerou e o carro saltou, espirrando água nos vidros
das janelas. E passou. Continuava a funcionar! Quando começou a subir uma encosta, os ponteiros no painel começaram a dançar loucamente, e ele ouviu o zumbido que
indicava um curto-circuito. Com uma explosão sob o capo, uma fumaça com cheiro acre saiu do radiador e o carro parou.
Quatro minutos.
Thorne ficou sentado no carro, ouvindo a chuva na capota de metal. Girou a chave. Nada aconteceu.
O motor estava morto.
A chuva descia como uma cachoeira pelo pára-brisa. Thorne recostou no banco, suspirou e olhou para a estrada. O rádio no banco ao seu lado deu sinal.
- Thorne? Está quase chegando?
Thorne olhou outra vez para a estrada, tentando descobrir onde estava. Calculou que faltavam uns dois quilômetros para chegar ao trailer, talvez mais. Muito
longe para ir a pé. Praguejou e bateu com a mão fechada no banco.
- Não, Eddie. Tive um curto.
- Teve o quê?
- Eddie, o carro morreu. Estou... Thorne não terminou a frase. Estava vendo alguma coisa.
Logo depois da curva, na sua frente, viu o brilho fraco de uma luz vermelha. Olhou com atenção para se certificar. Sim, seus olhos não o enganavam. A luz
vermelha estava lá, no meio da estrada.
Eddie disse:
- Thorne? Está ouvindo?
Thorne não respondeu. Apanhou o rádio e o rifle Lindstradt, saltou do carro, abaixou a cabeça por causa da chuva e correu, subindo a colina, na direção da
bifurcação logo adiante. Assim que saiu da curva, viu o jipe vermelho no meio da estrada do penhasco com as lanternas traseiras piscando. A luz de uma delas era
branca porque o plástico vermelho estava quebrado.
Thorne correu para o jipe e olhou para dentro. A luz de um relâmpago viu que estava vazio. A porta do motorista estava aberta e amassada no lado de fora.
Thorne entrou no carro e estendeu a mão para o painel... Sim, as chaves estavam no contato! Ele ligou a chave e o motor pegou imediatamente.
Thorne deu marcha à ré e entrou na estrada que ia dar na clareira. Depois de algumas poucas curvas, ele viu o telhado verde do laboratório e entrou para a
esquerda. Os faróis iluminaram a relva alta e os dois dinossauros que empurravam o trailer.
Os tiranossauros voltaram-se ao mesmo tempo, rugiram para o jipe de Thorne e, abandonando o trailer, avançaram. Thorne engatou a marcha à ré e acelerou freneticamente
antes de perceber que os animais não iam na sua direção.
Os tiranossauros atravessavam a clareira, correndo para a árvore perto de Thorne. Então pararam e olharam para cima. Thorne apagou os faróis e esperou. Agora
ele dependia da luz intermitente dos relâmpagos e num desses momentos viu quando eles tiraram o filhote da árvore. Outro relâmpago mostrou os dois tiranossauros
acariciando o filhote com os focinhos. Sua chegada intempestiva os fez temer pela segurança do filhote.
O relâmpago seguinte revelou que os animais tinham desaparecido na floresta. A clareira estava vazia. Teriam mesmo ido embora? Ou estavam se escondendo? Thorne
abaixou o vidro e pôs a cabeça para fora, na chuva. Ouviu então um som estranho, abafado e contínuo, como um grito, demasiado regular para ser feito por um animal.
Num instante ele compreendeu. Era o som de metal.
Thorne acendeu os faróis outra vez e seguiu em frente, devagar. Os tiranossauros não estavam em parte alguma. À luz dos faróis ele viu então o segundo trailer.
Com um rangido contínuo de metal, o trailer continuava a deslizar na relva na direção da beira do rochedo.
- O que ele está fazendo agora? - Kelly gritou por causa do ruído da chuva no telhado de metal.
- Está indo para o trailer. - Com os óculos de visão noturna, Levine via os faróis atravessando a clareira. - E está...
- Está o quê? - perguntou Kelly. - O que ele está fazendo?
- Está dando a volta numa árvore. Uma árvore grande, na clareira.
- Por quê?
- Deve estar passando o cabo do guindaste em volta da árvore
- disse Eddie. - É a única razão possível.
Depois de um momento de silêncio, Arby perguntou:
- O que ele está fazendo agora?
- Desceu do jipe e está correndo para o trailer.
Thorne estava de quatro na lama, segurando o gancho do guindaste do jipe. O trailer escorregava para longe do alcance de suas mãos, mas ele conseguiu entrar
debaixo dele e prender o gancho no eixo traseiro. Tirou a mão rapidamente quando o gancho se prendeu com firmeza na capa do freio e rolou o corpo para a relva. Seguro
pelo gancho, o trailer saltou de lado e caiu com os pneus batendo com força no chão, justamente no lugar que Thorne acabara de deixar.
O cabo de metal do guindaste retesou ao máximo e a parte inferior do chassis do trailer gemeu num protesto metálico.
Mas o cabo agüentou.
Thorne saiu de baixo do trailer e examinou as rodas do jipe para verse estavam imóveis. Com o cabo enrolado na árvore, o peso do jipe era suficiente para
manter o segundo trailer na borda do penhasco.
Thorne entrou no jipe e firmou o freio. Ouviu a voz de Eddie no rádio.
- Thorne!
- Estou aqui, Eddie.
- Conseguiu imobilizar o trailer?
- Sim, consegui.
- Isso é ótimo. Mas escute. Sabe que a conexão é feita com uma rede de fios sobre barras de aço. Não foi feita para...
- Eu sei, Eddie. Estou tratando disso. - Desceu do carro e correu na chuva até o trailer.
Abriu a porta e entrou. Não se via nada dentro do trailer. A desordem era completa. Sentiu vidro quebrado sob os pés. Todas as janelas estavam quebradas.
- Eddie - ele chamou.
- Sim, Thorne.
- Preciso de uma corda. - Sabia que Eddie tinha carregado uma porção de suprimentos às escondidas.
- Thorne...
- Só diga onde está.
- Está no outro trailer, Thorne.
No escuro, Thorne tropeçou numa mesa.
- Isso é ótimo.
- Deve haver corda de náilon no armário de ferramentas - Eddie disse. - Mas não sei quanta. - Eddie não parecia muito esperançoso.
Thorne experimentou as portas dos armários na parede do trailer. Estavam empenadas. O armário de ferramentas ficava logo adiante. Mas não havia nenhuma corda.
E naquele momento ele precisava de uma corda.

O TRAILER


Sarah Harding, ainda suspensa pelas mãos no alto do trailer, olhou para a conexão retorcida acima da sua cabeça. Já não ouvia as batidas surdas dos tiranossauros
no segundo trailer. Sentiu pingos de água no rosto e compreendeu o que isso significava.
A conexão sanfonada começava a vazar.
Olhou para cima e viu a abertura no tecido, descobrindo as espirais de aço que formavam a estrutura do tubo. Era uma abertura pequena ainda mas certamente
ia aumentar com rapidez. E à medida que o tecido fosse rasgando, as espirais iam esticar e se partir.
Em poucos minutos o primeiro trailer estaria solto e despencaria do rochedo.
Ela voltou para perto de Malcolm e firmou as mãos para não cair.
- Ian.
- Eu sei. - Ele balançou a cabeça.
- Ian, precisamos sair daqui. - Passou as mãos sob âs axilas dele, fazendo-o endireitar o corpo dobrado sobre a mesa. - E você vem comigo.
Malcolm balançou a cabeça, vencido. Sarah já conhecia aquele gesto fútil de desistência e detestou vê-lo naquele momento. Harding jamais desistia. Nunca.
- Eu não posso - gemeu Malcolm.
- Mas precisa. - Sarah...
- Não quero ouvir nada, Ian. Não temos tempo para conversar. Agora, vamos. - Sarah o empurrou e ele gemeu, mas endireitou o corpo. Com esforço ela o afastou
da mesa. Um relâmpago iluminou o trailer e ela pareceu recuperar as forças. Malcolm ficou de pé no sofá, de frente para a mesa. Cambaleava um pouco mas continuou
de pé.
- O que vamos fazer? - ele perguntou.
- Eu não sei, mas vamos sair daqui... Tem alguma corda no trailer?
Ele balançou a cabeça afirmativamente.
-Onde?
Malcolm apontou para baixo, para a frente do trailer suspenso no espaço.
- Lá na frente, debaixo do painel.
- Vamos.
Sarah inclinou o corpo no espaço e separou as pernas firman-do-as no chão do trailer à sua frente. Ficou na posição de um alpinista subindo por uma chaminé.
O painel do trailer estava seis metros abaixo.
- Muito bem, vamos.
- Eu não posso, Sarah. Falo sério.
- Então, apoie-se em mim. Eu o carrego.
- Mas...
- Agora, que droga!
Malcolm segurou numa saliência da parede com a mão trêmula. Estava arrastando a perna direita. Sarah sentiu o peso dele nas costas, quase fazendo-a soltar
as mãos. Malcolm passou os braços em volta do pescoço dela, sufocando-a. Sarah estendeu os braços para trás, segurou-o pela cintura e o ergueu, enquanto ele ajustava
melhor os braços. Finalmente ela conseguiu respirar.
- Desculpe - ele disse.
- Tudo bem. Agora vamos.
Ela começou a descer a passagem vertical, segurando em tudo o que encontrava. Em certos lugares havia alças, e em outros ela se firmava nos fechos das gavetas,
pernas de mesas, fechos de janelas. Quando procurou se firmar no carpete, o tecido rasgou, ela começou a escorregar, firmou as pernas e parou de cair. Malcolm, utrás
dela, respirava com dificuldade. Seus braços tremiam em volta do pescoço de Sarah. Ele disse:

- Você é muito forte.
- Mas sempre feminina - ela disse.
Estavam a três metros do painel na frente do trailer. Dois metros. Sarah encontrou uma alça na parede e segurou com força, abaixando as pernas. Seus pés
tocaram a direção e ela desceu lentamente, soltando Malcolm no painel. Ele deitou, ofegante.
O trailer rangia e balançava. Sarah procurou debaixo do painel, encontrou a caixa e a abriu. As ferramentas caíram da caixa com um ruído metálico. E ela encontrou
a corda. Era de náilon, e devia ter uns quinze metros de comprimento.
Sarah ficou de pé e olhou pelo pára-brisa para o fundo do vale mais de cem metros abaixo. A porta do motorista estava à sua direita. Ela a abriu. A porta
bateu contra o lado de fora do trailer e^ Sarah sentiu a chuva no rosto.
Sarah inclinou-se para fora e examinou o lado do trailer. Segurando com força a maçaneta, dobrou o corpo para ver a parte inferior. Ouviu um ruído de metal
e alguém disse:
- Até que enfim! - Um vulto grande apareceu de repente na frente dela. Era Thorne, dependurado no chassis.
- Pelo amor de Deus - Thorne disse. - O que vocês estão esperando, um convite impresso? Vamos embora!
-É Ian - Sarah disse.
- Está ferido.

Típico, pensou Kelly, olhando para Arby. Quando a barra pesa, ele não agüenta. Muita emoção, muita tensão e ele fica todo trêmulo e apavorado. Há muito tempo
Arby tinha dado as costas para os dois trailers no penhasco e estava olhando para o outro lado do abrigo, na direção do rio. Quase como se nada estivesse acontecendo.
Típico.
- O que está acontecendo agora? - ela perguntou para Levine.
- Thorne acaba de entrar. - Levine continuou a olhar com os óculos de visão noturna.
- Ele entrou? Quer dizer, no trailer?
- Sim. E agora alguém está saindo.
- Quem?
- Acho que é Sarah. Ela está tirando todo o mundo do trailer.
Kelly se esforçou para ver no escuro. Quase não chovia, agora caía apenas uma garoa fina. Na outra extremidade do vale, o trailer continuava girando no espaço.
Ela teve a impressão de ver alguém dependurado no chassis. Mas não tinha certeza.
- O que ela está fazendo?
- Subindo.
- Sozinha?
- Sim - disse Levine. - Sozinha.

Sarah Harding saiu pela porta, girando o corpo na chuva. Não olhou para baixo. Sabia que o vale estava cento e cinqüenta metros abaixo. O trailer balançava.
Estava com a corda no ombro. Ela se moveu cautelosamente, estendeu a perna e ficou de pé na caixa de câmbio. Segurou um cabo e virou o corpo. De dentro do trailer,
Thorne disse:
- Não vamos conseguir tirar Malcolm com a corda. Você pode subir pelo trailer?
Um relâmpago iluminou a parte inferior do trailer e Sarah viu o brilho leve de graxa. Depois, o escuro outra vez.
- Sarah, acha que pode?
- Sim - ela disse. Ergueu os braços e começou a subir.

No abrigo de metal Kelly disse:
- Onde ela está? O que está acontecendo? Ela está bem?
- Ela está subindo pelo trailer - Levine disse.
Arby, de costas, olhava para o rio e as vozes no abrigo pareciam distantes. Impaciente, ele esperava o próximo relâmpago. Esperava para ver se era verdade
o que tinha visto um pouco antes.

Ela não sabia como mas, escorregando e deslizando, conseguiu chegar ao alto do rochedo. Não podia perder tempo. Sarah desenrolou a corda e se arrastou para
debaixo do segundo trailer. Passou a corda pelo gancho de metal e deu um nó rápido e firme. Voltou para a beirada do rochedo e atirou a outra ponta para baixo.
- Thorne! - ela gritou.
De pé no traíler, Thorne apanhou a corda e a amarrou na cintura de Malcolm. Malcolm gemeu.
- Vamos - Thorne disse. Passou os braços em volta de Malcolm e, com um impulso, saiu com ele do trailer, balançando o corpo até ficarem os dois de pé na
caixa de câmbio.
- Cristo - Malcolm disse, olhando para cima. Sarah começou a puxar a corda.
- Use só os braços - Thorne disse.
Malcolm começou a ser içado. Logo estava três metros acima de Thorne. De onde estava Thorne não via Sarah lá em cima. Ian estava entre os dois. Thorne começou
a subir, procurando apoio para as pernas. A parte inferior do trailer estava escorregadia. Ele pensou, eu devia ter feito isto à prova de derrapagem. Mas quem ia
pensar em fazer a parte inferior de um veículo à prova de derrapagem?
Mentalmente ele via a conexão entre os dois trailers rangendo lentamente... o tecido cada vez mais aberto...
Thorne subiu. Uma das mãos depois da outra. Um pé depois do outro.
A luz do relâmpago viu que estavam perto do topo.

Sarah, de pé no alto do rochedo, estendeu a mão para Malcolm, que subia usando só os braços, com as pernas soltas. Mas estava subindo. Mais um pouco... Sarah
segurou o colarinho dele e o puxou para cima. Malcolm caiu deitado no alto do rochedo.
Thorne continuou a subir. Seus pés escorregavam. Seus braços doíam.
Ele subia.
Sarah estendeu a mão para ele.
- Vamos, Thorne - ela disse.
A mão dela estava estendida, os dedos quase o alcançando.
Com um ruído surdo o tecido se partiu e o trailer despencou dez metros, com as espirais de aço começando a se esticar.
Thorne começou a subir mais depressa, olhando para cima, para Sarah.
Ela continuava com a mão estendida.
- Você vai conseguir, Thorne...
Thorne continuou a subir. Fechou os olhos e subiu, segurando a corda com força. Seus braços, seus ombros eram uma dor só e a corda parecia diminuir de tamanho
em suas mãos. Thorne a enrolou no pulso, para não soltar. Mas no último instante ele começou a escorregar e sentiu uma dor ardida no alto da cabeça.
- Desculpe - Sarah disse, puxando-o pelos cabelos.
A dor era intensa, mas Thorne mal notava porque agora estava ao lado da conexão sanfonada, vendo as espirais de fio de aço se partindo. O trailer caiu mais
alguns metros, mas ela continuava puxando. Ela era extremamente forte e, então, os dedos dele tocaram a relva e ele estava no alto do penhasco. Salvo.
Ouviram uma série de estalos metálicos - as espirais se partiram, uma depois da outra e, com um último gemido, o trailer se soltou e despencou, ficando cada
vez menor até bater com estrondo nas rochas lá embaixo.
Thorne olhou para Sarah.
- Obrigado - ele disse.
Sarah sentou pesadamente no chão, ao lado dele. O sangue pingava do ferimento na testa dela. Sarah abriu a mão e deixou cair um punhado do cabelo grisalho
de Thorne.
- Uma noite de inferno - ela disse.

O POSTO DE OBSERVAÇÃO


Observando com os óculos de visão noturna, Levine disse:
- Eles conseguiram!
- Todos? - perguntou Kelly.
- Sim! Eles conseguiram!
Kelly começou a pular e gritar de alegria. Arby voltou-se rapidamente e tirou os óculos das mãos de Levine.
- Ei - disse Levine. - Espere um pouco...
- Preciso deles - disse Arby. Deu as costas para Levine e olhou para a planície escura. A princípio não viu nada, só uma névoa verde. Encontrou o regulador
de foco e a imagem apareceu.
- Que diabo pode sertão importante? - disse Levine, irritado. - Esse é um equipamento muito caro...
Então, ouviram o rosnado. Estava se aproximando.

No meio dos tons de verde luminoso, Arby via perfeitamente os raptores. Eram doze, movendo-se em grupo pela relva, na direção do abrigo. Um deles ia um pouco
à frente e parecia ser o líder. Mas era difícil perceber qualquer organização no grupo. Os raptores rosnavam, lambendo o sangue nos focinhos, enxugando com os antebraços
que terminavam em garras, um gesto estranhamente inteligente, quase humano. Com os óculos de visão noturna, Arby via os olhos verdes brilhando no escuro.
Aparentemente não tinham visto o abrigo lá no alto. Nem uma vez olharam para ele. Mas não havia dúvida de que estavam indo naquela direção.
De repente, os óculos foram arrancados das mãos de Arby.
- Com licença - Levine disse. - Acho melhor eu me encarregar disso.
- Se não fosse por mim, você nem ia saber - disse Arby.
- Fique quieto - ordenou Levine, levando os óculos aos olhos e ajustando o foco. Estava vendo vinte animais a cerca de vinte metros do abrigo.
- Eles podem nos ver? - Eddie perguntou, em voz baixa.
- Não. E estamos contra o vento, portanto não podem nos farejar. Acho que estão seguindo a trilha que passa pelo abrigo. Se ficarmos quietos, eles vão passar
direto.
O rádio de Eddie estalou, e ele se apressou a desligá-lo.
Todos olhavam para a planície. A noite agora estava calma e parada. Não chovia e a lua começava a aparecer entre as nuvens muito finas. Dava para ver os vultos
dos animais contra a relva prateada.
- Eles podem subir aqui? - Eddie murmurou.
- Não vejo como - Levine respondeu, no mesmo tom. - Estamos quase seis metros acima do solo. Acho que estamos seguros.
- Mas você disse que eles sobem em árvores.
- Ssh. Isto não é uma árvore. Agora, todos abaixados e quietos.
Malcolm gemeu de dor quando Thorne o deitou numa mesa no segundo trailer.
- Parece que não tenho muita sorte com essas expedições, não é mesmo?
- Não, não tem - Sarah disse. - Procure se acalmar, Ian. A luz de uma lanterna, Thorne cortou a perna da calça de
Malcolm. Viu um corte profundo na perna direita e ele tinha perdido muito sangue. Sarah disse:
- Temos uma caixa de primeiros-socorros?
- Acho que sim, no lado de fora, onde guardamos a moto.
- Vá buscar.
Thorne saiu do trailer. Sarah iluminou o ferimento com a lanterna e examinou atentamente. Malcolm perguntou:
- É grave?
- Podia ser pior - Sarah disse, secamente. - Vai sobreviver. Na verdade, era um corte profundo, quase até o osso. Por sorte não atingira a artéria. Mas o
ferimento estava sujo. Sarah viu graxa e folhas amassadas no músculo ferido. Precisava limpar, mas ia esperar o efeito da morfina.
- Sarah - Malcolm disse. - Devo minha vida a você.
- Esqueça disso, Ian.
- Não, é verdade.
- Ian - Sarah olhou para ele. - Essa sinceridade não combina com você.
- Vai passar - ele sorriu.
Sarah sabia que ele devia estar sentindo muita dor. Thorne voltou com a caixa, ela encheu a seringa, bateu para tirar o ar se injetou no ombro de Malcolm.
- Ai. Quanta morfina está me dando? - ele perguntou.
- Muita.
- Por quê?
- Porque preciso limpar o ferimento, Ian. E você não vai gostar.
Malcolm suspirou e disse para Thorne.
- Já é alguma coisa, certo? Vá em frente, Sarah, faça o pior que puder.

Levine observava a aproximação dos raptores com os óculos de visão noturna. Eles se moviam em grupo não muito cerrado com o passo saltado característico da
espécie. Levine observava atento, esperando ver alguma organização no grupo, algum sinal de uma hierarquia dominante. Os velocirraptores são inteligentes e seria
lógico que se organizassem hierarquicamente. Isso apareceria na sua configuração espacial. Mas Levine não via nada disso. Eram como um bando de saqueadores, sem
forma definida, silvando e provocando-se uns aos outros.
Estavam os quatro agachados no abrigo, Eddie com um braço em volta de cada um dos meninos para tranqüilizá-los. Arby parecia em pânico. Kelly aparentemente
estava bem. Ela era mais calma.
Levine não via nenhum motivo para medo. Estavam perfeitamente seguros ali em cima. Ele observava o bando com distanciamento acadêmico, tentando perceber um
padrão nos movimentos rápidos dos animais.
Não havia dúvida de que estavam seguindo a trilha, exatamente como os parassauros haviam feito naquele mesmo dia, vindos do rio, subindo a pequena elevação
e atravessando a clareira, passando por trás do abrigo. Os raptores não deram a mínima atenção à pequena casa no alto. Pareciam mais interessados na interação do
bando.
Chegaram ao lado da estrutura e iam continuar, quando o que estava mais próximo parou. Deixou passar todo o bando, farejando o ar. Então se inclinou para
a frente e começou a farejar a relva em volta da base do andaime.
O que ele estava fazendo? pensou Levine.
O raptor solitário rosnou e continuou a fuçar a relva. Então ergueu o corpo e Levine viu que ele segurava alguma coisa com os dedos em garra. Levine esforçou-se
para ver o que era.
Era um pedaço de papel da barra de chocolate.
O raptor olhou para cima, para o abrigo, e seus olhos brilharam no escuro. Olhou diretamente para Levine. E rosnou.

MALCOLM


- Como está? - perguntou Thorne.
- Cada vez melhor - disse Malcolm. Suspirou e relaxou o corpo. - Quer saber, há uma boa razão para certas pessoas gostarem de morfina.
Sarah Harding ajustou a tala inflável de plástico em volta da perna de Malcolm e disse para Thorne:
- A que horas chega o helicóptero? Thorne consultou o relógio.
- Em menos de cinco horas. Ao nascer do dia, amanhã.
- Com certeza?
- Sim, certeza absoluta.
- Tudo bem. Ele vai ficar bem.
- Estou ótimo - disse Malcolm com voz sonhadora. - Só sinto que a experiência esteja no fim. Uma experiência e tanto. Tão elegante. Tão especial e única.
Darwin não sabia de nada.
- Vou limpar isto agora - Sarah disse para Thorne. - Segure a perna dele para mim. - Em voz mais alta dirigiu-se a Malcolm.
- O que Darwin não sabia, Ian?
-Que a vida é um sistema complexo e tudo o que isso implica. Paisagens aptas. Processo de adaptação. Redes booleanas. Comportamento auto-organizado. Pobre
homem. Ai! O que você está fazendo aí?
- Conte para nós - Sarah disse, inclinada sobre o ferimento.
- Darwin não tinha idéia...
- De que a vida é tão incrivelmente complexa - disse Malcolm. - Ninguém percebe isso. Quero dizer, um único ovo fertilizado tem centenas de milhares de genes
que agem de modo coordenado, mudando em tempos determinados, para transformar aquela única célula numa criatura viva completa. Aquela célula única começa a se dividir,
mas as células subseqüentes são diferentes. Elas se especializam. Algumas são nervos. Algumas são as entranhas. Algumas são os membros. Cada conjunto de células
começa a seguir o próprio programa, desenvolvendo, interagindo. Finalmente existem duzentas e cinqüenta espécies diferentes de células, todas desenvolvendo juntas,
exatamente no tempo certo. No momento em que o organismo precisa de um sistema circulatório, o coração começa a bombear. Quando os hormônios são necessários, as
supra-renais começam a fabricá-los. Semana após semana, esse desenvolvimento extremamente complexo se processa com perfeição - com perfeição. É incrível. Nenhuma
atividade humana chega perto disso.
"Quero dizer, você já construiu uma casa? Uma casa é simples em comparação. Mesmo assim, os operários erram na construção da escada, instalam a pia de trás
para diante, o encarregado do telhado não aparece no dia combinado. Uma porção de coisas saem erradas. Porém, a mosca que pousa no almoço do operário é perfeita.
Ai! Vá com calma!"
- Desculpe - ela disse, continuando a limpar o ferimento.
- Mas o importante - continuou Malcolm - é que esse complexo processo de desenvolvimento na célula é algo que mal podemos descrever, muito menos compreender.
Já pensou nos limites da nossa compreensão? Matematicamente, podemos descrever duas coisas interagindo, como dois planetas no espaço. Três coisas interagindo - três
planetas no espaço -, bem, isso já é um problema. Quatro ou cinco coisas interagindo, isso não é possível para nós. E dentro da célula há centenas de milhares de
coisas interagindo. Temos de desistir. É tão complexo - como é possível a existência da vida? Algumas pessoas pensam que a resposta esteja no fato da auto-organização
das coisas vivas. A vida cria uma ordem própria, como acontece com a cristalização. Algumas pessoas pensam que a vida se cristaliza no ser e é assim que a complexidade
é dirigida.
"Porque, se você não souber nada de química fisiológica, pode olhar para um cristal e fazer a mesma pergunta. Você vê aquelas lindas estrias, aquelas facetas
perfeitamente geométricas e pode perguntar: o que controla esse processo? Como o cristal adquire essa formação tão perfeita e tão parecido com todos os outros cristais?
Mas acontece que um cristal é apenas o modo como as forças moleculares se dispõem em forma sólida. Ninguém controla. Acontece sozinho. Fazer uma porção de perguntas
sobre um cristal significa que você não compreende a natureza fundamental do processo que leva à sua criação.
"Assim, talvez as formas vivas sejam uma espécie de cristalização. Talvez a vida apenas aconteça. E talvez, como nos cristais, exista uma ordem característica
nas coisas vivas, gerada pela interação dos seus elementos. Muito bem. Uma das coisas que os cristais nos ensinam é que a ordem pode surgir muito depressa. Num minuto
temos um líquido, com todas as moléculas se movendo ao acaso. No minuto seguinte, forma-se o cristal e todas a moléculas se unem numa ordem determinada. Certo?"
- Certo...
- Muito bem. Agora, pense na interação das formas de vida no planeta para formar o ecossistema. E mais complexo do que um único animal. Toda a disposição
é muito complicada. Como a planta da iúca. Você sabe?
- Conte.
- A iúca depende de um determinado inseto, que junta o pólen formando uma bola e leva a bola para outra planta - não para a flor da mesma planta - e esfrega
a bola na planta, fertilizando-a. Só então o inseto põe os ovos. A iúca não pode sobreviver sem o inseto. O inseto não sobrevive sem a planta. Uma interação complexa
como essa nos faz pensar que talvez o comportamento seja uma espécie de cristalização também.
- Você está falando metaforicamente? - Sarah disse.
- Estou falando sobre toda a ordem no mundo natural. E sobre como talvez ela possa surgir rapidamente, por meio da cristalização. Porque o comportamento dos
animais complexos pode evoluir rapidamente. As mudanças podem ocorrer com grande rapidez. Os seres humanos estão transformando o planeta e ninguém sabe se é um desenvolvimento
perigoso ou não. Assim, esses processos comportamentais podem ocorrer com maior rapidez que o que pensamos ocorrer com evolução. Em dez mil anos o ser humano passou
da caça para a agricultura, das cidades para o espaço cibernético. O comportamento está avançando rapidamente e pode ser não-adaptativo. Ninguém sabe. Embora eu
ache que o espaço cibernético significa o fim da nossa espécie.
- Sim? E por quê?
- Porque significa o fim da inovação - disse Malcolm. - A idéia de que o mundo todo está ligado é morte em massa. Todo biólogo sabe que grupos pequenos isolados
evoluem com maior rapidez. Se pusermos dez mil pássaros numa ilha oceânica vão evoluir rapidamente. Se pusermos dez mil num grande continente a evolução é mais lenta.
Ora, na nossa espécie, a evolução ocorre especialmente por meio do comportamento. Inventamos um novo comportamento para nos adaptar. E todos no mundo sabem que a
inovação só ocorre em pequenos grupos. Se pusermos três pessoas num comitê, elas podem conseguir fazer alguma coisa. Dez pessoas, fica mais difícil. Trinta pessoas,
nada acontece. Trinta milhões, torna-se impossível. Esse é o efeito dos meios de comunicação de massa - impede que as coisas aconteçam. A comunicação de massa simplesmente
afoga a diversidade. Faz com que todos os lugares fiquem iguais. Em Bangcoc, Tóquio ou Londres, encontramos um McDonald´s numa esquina, uma Benneton em outra, um
Gap no outro lado da rua. As diferenças regionais desaparecem. Todas as diferenças desaparecem. No mundo da comunicação de massa, há menos de tudo exceto os dez
livros mais vendidos, discos, filmes, idéias. O povo se preocupa, temendo perder a diversidade das espécies na floresta tropical. Mas e a diversidade intelectual,
nosso recurso mais necessário? Essa está desaparecendo com maior rapidez do que as árvores. Mas ainda não percebemos isso, e agora estamos pensando em pôr cinco
bilhões de pessoas juntas no espaço cibernético. E isso vai congelar todas as espécies. Tudo vai parar e morrer. Todos pensando a mesma coisa ao mesmo tempo. Uniformidade
global. Ai, isso dói! Ainda não terminou?
- Quase - disse Harding. - Agüente mais um pouco.
- E acredite, vai ser rápido. Se você mapear sistemas complexos numa paisagem de perfeição vai descobrir que o comportamento pode se mover tão depressa que
a perfeição diminui numa rapidez incrível. Não precisa de asteróides ou doenças, nada mais. E só um comportamento que surge de repente e acaba sendo fatal para a
criatura que o usa. Minha idéia é que os dinossauros, sendo criaturas complexas, devem ter passado por uma dessas mudanças de comportamento. E isso os levou à extinção.
- O quê, todos eles?
- Basta alguns - disse Malcolm. - Alguns dinossauros apodrecem nos pântanos em volta do mar interior. Isso muda a circulação da água e destrói a ecologia
vegetal da qual vinte e outras espécies dependem. Bang! Eles desaparecem. Isso provoca novos deslocamentos. Um predador morre e sua presa começa a procriar sem nenhuma
limitação. O ecossistema se desequilibra. Outras coisas dão errado. Mais espécies morrem. E de repente, tudo acabou. Pode ter acontecido assim.
- Apenas comportamento...
- Sim - disse Malcolm. - De qualquer modo, essa é a idéia. E tive o belo pensamento de que podemos provar isso... Mas agora terminou. Precisamos sair daqui.
Acho melhor dizer aos outros.
Thorne ligou o rádio.
-Eddie? Sou eu, Thorne. Nenhuma resposta.
- Eddie?
E então ouviram um ruído que a princípio parecia estática. Só um pouco depois compreenderam que era um grito humano incri-- velmente estridente.

O POSTO DE OBSERVAÇÃO


0 primeiro raptor, com um silvo longo, começou a dar saltos, tentando subir no andaime, balançando a estrutura. Suas garras escorregavam no metal e ele caía
no chão. Eddie admirou-se com a altura que ele conseguia saltar - dois metros e meio na vertical, um salto depois do outro, sem esforço aparente. Os saltos atraíram
os outros animais, que voltaram e cercaram o andaime com a pequena casa no alto.
Logo estavam todos saltando e rosnando em volta do abrigo. A estrutura balançava a cada impacto, a cada tentativa de se agarrar nas barras de alumínio. Porém
o mais incrível, Levine notou, era que eles estavam aprendendo. Alguns começavam a usar os braços para se firmar, enquanto as pernas procuravam um ponto de apoio.
Um dos raptores chegou a poucos centímetros do abrigo antes de cair outra vez. Eles nunca pareciam se ferir nas quedas. Levantavam imediatamente e davam outro salto.
Eddie e os meninos ficaram de pé. Levine disse:
- Afastem-se da grade! Não olhem para baixo! - Empurrou os meninos para o centro do abrigo.
Eddie tirou da mochila um sinalizador luminoso e atirou para um dos lados do abrigo. Dois raptores caíram. O foguete explodiu na relva molhada desenhando
sombras vermelhas. Mas os raptores continuaram o ataque. Eddie tirou uma barra de alumínio do chão e se inclinou para fora, brandindo a arma como um taco.
Um dos raptores já havia subido o bastante para avançar com a boca aberta para o pescoço de Eddie. Surpreso, ele gritou e recuou rapidamente. As mandíbulas
do raptor fecharam-se na sua camisa.
Então o raptor caiu para trás, e seu peso puxou Eddie por cima da grade do abrigo.
Ele gritou: "Me ajudem! Me ajudem!" Levine passou o braço pela cintura dele e o puxou para dentro, depois olhou para o raptor, por cima do ombro de Eddie.
O animal estava suspenso no espaço, rosnando furioso, com a camisa ainda entre os dentes. Eddie bateu no focinho dele com a barra de metal. Mas o raptor ficou firme,
como um buldogue. Equilibrado precariamente, Eddie podia cair a qualquer momento.
Ele enfiou a barra no olho do animal e o raptor imediatamente abriu a boca e largou a camisa. Os dois homens caíram de costas no meio do abrigo. Quando levantaram,
viram os raptores subindo nos lados do andaime. Quando eles apareceram, Eddie os atacou com a barra e os derrubou.
- Depressa! - ele gritou para os meninos. - Para o telhado! Rápido!
Kelly começou a subir por uma das barras, e chegou ao telhado com facilidade. Arby ficou parado, o rosto inexpressivo. Ela olhou para baixo e disse:
- Venha, Arb.
O menino estava petrificado, os olhos arregalados de medo. Levine correu para ajudá-lo a subir. Eddie estava brandindo a barra de metal de um lado para o
outro, atacando os raptores.
Um dos animais apanhou a barra com os dentes e puxou. Eddie perdeu o equilíbrio, girou o corpo e caiu para trás e para fora. "Nããão!", gritou, caindo. Imediatamente
todos os animais desceram para o chão. Ouviram os gritos de Eddie na noite. Os raptores rosnavam.
Levine, apavorado, estava ainda com Arby nos braços, er-guendo-o para o telhado.
- Vá - ele repetia. - Vá. Vá. Kelly, no telhado dizia:
- Você pode, Arby, você pode.
O menino segurou a borda do telhado e ergueu o corpo agitando as pernas, em pânico. Acertou um pontapé na boca de Levine que o largou. Ele viu o menino escorregar
e cair para trás e para fora do abrigo.

- Oh, Cristo! - Levine disse. - Oh, Cristo!

Thorne estava debaixo do trailer, soltando o cabo. Saiu e correu para o jipe. Ouviu o zumbido de um motor e viu Sarah saindo a toda velocidade na moto, com
o rifle Lindstradt pendurado no ombro.
Ele entrou no jipe, ligou o motor e esperou impaciente que o cabo acabasse de ser enrolado, olhando para o gancho que deslizava na relva. Para ele foi uma
eternidade. Agora o cabo estava dando voltas na árvore. Ele esperou. Viu a luz da moto de Sarah entre a folhagem, correndo na direção do abrigo.
Finalmente o motor do guindaste parou. Thorne ligou a marcha e saiu a toda da clareira. Ouviu o rádio e disse:
- Ian.
- Não se preocupe comigo - Malcolm disse com voz sonhadora. - Eu estou ótimo.

Kelly estava deitada no telhado do abrigo, olhando para baixo. Ela viu Arby chegar ao solo, no lado oposto ao de Eddie. Teve a impressão de que o impacto
foi muito forte. Mas não sabia o que acontecera porque teve de virar o corpo para firmar mais a mão no telhado molhado e, quando olhou outra vez, Arby tinha desaparecido.
Desaparecido.

Sarah Harding seguiu a toda pela estrada de lama na selva. Não sabia ao certo onde estava, mas achou que se continuasse descendo ia parar na planície. Pelo
menos era o que esperava.
Ela acelerou, passou uma curva e de repente viu uma árvore atravessada na estrada. Freou bruscamente, virou a moto e voltou por onde tinha vindo. Mais adiante
ela viu as luzes traseiras do jipe tle Thorne, entrando para a direita. Ela fez o mesmo, acelerando ao máximo.

LevineI estava no centro do abrigo, paralisado de terror. Os raptores não estavam saltando, já não tentavam subir na estrutura de metal. Estavam todos lá
embaixo, rosnando. Levine ouviu o som de ossos sendo mastigados. O menino não gritou, não emitiu qualquer som.
Levine suava frio.
Então ouviu a voz de Arby gritando:
- Para trás! Para trás!

No telhado, Kelly virou o corpo e olhou para o outro lado. A luz fraca do sinalizador, ela viu Arby dentro da gaiola. Ele tinha conseguido fechar a porta
e estava passando a mão pelas barras para girar a chave. Três raptores estavam perto dele. Saltaram para a frente quando a mão apareceu e ele a retirou rapidamente,
gritando, "Para trás!" Os raptores começaram a morder as barras da gaiola, balançando a cabeça de um lado para o outro. Um deles prendeu a mandíbula inferior no
elástico pendurado na chave. Ele levou a cabeça para trás, esticando o elástico e de repente a chave saltou da fechadura, batendo com força no pescoço do animal.
O raptor berrou, surpreso, e recuou. O elástico estava enrolado na sua mandíbula, a chave brilhando à luz do sinalizador. O raptor tentou se livrar, puxando
inutilmente o elástico que estava preso em seus dentes e cada vez que era puxado estalava no focinho dele. Então ele começou a esfregar o focinho no chão, procurando
se livrar da chave.
Enquanto isso os outros raptores conseguiram soltar a gaiola -da superestrutura, derrubando-a. Depois de tentar atingir Arby com marradas violentas, começaram
a chutar as grades. Outros animais se juntaram a eles. Logo eram sete os raptores em volta da gaiola. A força de pontapés eles a fizeram rolar para longe de abrigo.
Os animais impediam que Kelly visse Arby.
Ouviu o som de motor, ergueu a cabeça e viu os faróis do carro.
Alguém estava chegando.

Arby estava no inferno, dentro da gaiola, com os vultos negros rosnando em volta dele. Os raptores não conseguiam passar os focinhos entre as barras, mas
a saliva quente caía em cima dele e, quando atacavam com os pés, as garras arranhavam seus braços e seus ombros. Estava com o corpo todo ferido. A cabeça machucada
com as pancadas nas barras da jaula. Seu mundo era um pandemônio confuso e aterrador. Arby só tinha certeza de uma coisa.
Os raptores estavam levando a gaiola para longe do abrigo.

Quando o carro se aproximou, Levine olhou para baixo. Iluminados pela luz do sinalizador que queimava no chão, ele viu três raptores arrastando para a selva
o que restava do corpo de Eddie. Eles paravam várias vezes para disputar a presa, mas mesmo assim conseguiam levá-lo para as árvores.
Então ele viu outro grupo de raptores chutando e empurrando a gaiola. Eles a empurraram pela trilha e entraram na floresta.
Levine ouviu o motor do jipe e viu Thorne na direção.
Esperava que Thorne tivesse uma arma. Levine queria matar cada um daqueles animais malditos. Queria matar todos.

Kelly, no telhado, via os raptores chutando a gaiola, empurrando-a para longe. Um raptor ficou para trás, rodando em círculos como um cachorro frustrado.
Era o que estava com o elástico preso na boca. A chave pendurada no pescoço do animal brilhava na luz. O raptor balançava a cabeça para cima e para baixo violentamente.
O jipe chegou roncando e o raptor pareceu confuso com as luzes dos faróis. Thorne acelerou, lançando o carro para cima do animal. O raptor deu meia-volta
e correu para a planície.
Kelly desceu do telhado e depois para o chão.

Thorne abriu a porta, e Levine entrou no jipe.
- Eles levaram o garoto. - Levine apontou para a trilha. Kelly correu para eles, gritando.
- Esperem!
- Volte lá para cima - Thorne disse. - Sarah vem aí! Nós vamos apanhar Arby!
- Mas...
- Não podemos perder os animais de vista. - Thorne acelerou e seguiu pela trilha, atrás dos raptores.
No trailer, Ian Malcolm ouvia as vozes gritando no rádio. Ouvia o pânico, a confusão.
Tudo está indo para o inferno ao mesmo tempo - ele pensou.
Centenas de milhares de coisas interagindo.
Suspirou e fechou os olhos.

Thorne acelerava. A selva cerrada se fechou em volta deles. A trilha ficava cada vez mais estreita, as árvores enormes cada vez chegavam mais perto.
- Acha que vamos conseguir? - ele perguntou.
- Tem largura suficiente - disse Levine. - Passei por ela a pé esta manhã. Os parassauros usam este caminho.
- Como isso aconteceu? - perguntou Thorne. - A gaiola estava presa ao andaime.
- Eu não sei. Ela se soltou.
- Como? Como?
- Eu não vi. Aconteceu muita coisa.
- E Eddie? - Thorne perguntou sombriamente.
- Foi rápido - disse Levine.
O jipe seguia no meio da selva, saltando na trilha dos animais. As cabeças dos dois homens batiam na capota. Thorne dirigia a toda. Os raptores moviam-se
também com rapidez. Thorne mal podia ver o último saltando no escuro à sua frente.

- Eles não quiseram ouvir! - Kelly gritou, quando Sarah parou a moto ao lado dela.
- Ouvir o quê?
- O raptor levou a chave! Arby está trancado na gaiola e o raptor levou a chave.
- Para onde?
- Para lá. - Ela apontou para o outro lado da planície. À luz da lua elas viam o vulto escuro do raptor fugindo. - Precisamos da chave!
- Suba aí - Sarah disse, tirando o rifle do ombro. Kelly subiu na garupa da moto e Sarah pôs o rifle nas mãos dela. - Você sabe atirar?
- Não. Quero dizer, eu nunca...
- Sabe dirigir uma moto?
- Não, eu...
- Então você tem de atirar - disse Sarah - Preste atenção. Este é o gatilho, certo? O pino de segurança fica aqui. Você gira assim. Entendeu? Vai ser uma
corrida dura, por isso não solte o pino de segurança até chegarmos perto.
- Perto do quê?
Mas Sarah não ouviu. Acelerou e partiram pela planície atrás do raptor. Kelly passou um braço pela cintura de Sarah e procurou se firmar.

O jipe saltava na trilha da selva, espirrando lama dos dois lados.
- Não me lembro de a trilha ser tão difícil - Levine disse. - Talvez seja melhor ir mais devagar...
- Não, que diabo - disse Thorne. - Se os perdermos de vista, estará acabado. Não sabemos onde fica o ninho dos raptores. E nesta selva, no meio da noite...
Ah, droga!
Mais adiante os raptores estavam saindo da trilha, correndo para o mato cerrado. A gaiola tinha desaparecido. Thorne não via muito bem o caminho que estavam
seguindo, mas parecia uma descida quase vertical.
- Não podemos descer - disse Levine. - É muito íngreme.
- Tenho de conseguir.
- Não seja louco - insistiu Levine. - Encare os fatos. Nós perdemos o garoto. E uma pena, mas nós o perdemos.
Thorne olhou furioso para Levine.
- Ele não desistiu de você - ele disse. - E nós não vamos desistir dele.
Thorne virou a direção e levou o jipe para o topo da descida. A frente do carro mergulhou assustadoramente, ganhou velocidade e começou a descer.
- Droga! - gritou Levine. - Vai nos matar!
- Segure firme!
Aos saltos, ele seguiram no meio da selva escura.


SEXTA CONFIGURAÇÃO


A ordem entra em colapso simultaneamente em várias
regiões. A sobrevivência agora é pouco provável para os
indivíduos e para os grupos.


IAN MALCOLM

A PERSEGUIÇÃO


A moto seguiu velozmente por entre a relva alta da planície. Kelly segurava em Sarah com uma das mãos e com a outra segurava o rifle pesado. Seu braço começava
a cansar. A moto saltava no terreno acidentado. O vento soprava o cabelo contra seu rosto.
- Segure firme! - Sarah gritou.
A lua apareceu entre as nuvens, e a relva ficou prateada. O raptor estava quarenta metros à frente, ainda ao alcance dos faróis da moto. Estavam diminuindo
a distância. Kelly não via nenhum outro animal na planície, a não ser o bando distante de apatossauros.
Chegaram perto do raptor. O animal corria velozmente, com a cauda rígida no ar, quase invisível na relva alta. Sarah virou a moto para a direita e emparelhou
com o animal. Chegavam cada vez mais perto. Ela se inclinou para trás e gritou, aproximando a boca do ouvido de Kelly.
- Prepare-se!
- O que eu faço?
Estavam correndo ao lado da cauda do raptor. Sarah acelerou, passando pelas pernas, movendo-se para a direção da cabeça.
- O pescoço! - ela gritou. - Atire no pescoço!
Kelly segurou a arma desajeitadamente.
- Agora?
- Não! Espere! Espere!
O raptor entrou em pânico quando a moto se aproximou e aumentou a velocidade.
Kelly estava tentando encontrar o pino de segurança. A arma balançava em sua mão. Seus dedos tocaram o pino, escorregaram.
Tentou outra vez. Ia precisar das duas mãos e isso significava soltar a cintura de Sarah...
- Prepare-se! - Sarah gritou.
- Mas eu não posso...
- Agora! Atire! Agora!
Sarah virou a moto rapidamente e emparelhou com a cabeça do raptor. Estavam muito perto, e Kelly sentia o cheiro do animal. O raptor virou a cabeça e abriu
e fechou a boca ameaçadoramente. Kelly atirou. A arma saltou em suas mãos e ela agarrou a cintura de Sarah outra vez. O raptor continuou a correr.
- O que aconteceu?
- Você errou!
Kelly balançou a cabeça.
- Não faz mal - Sarah gritou. - Você vai conseguir! Vou chegar mais perto.
Virou a moto na direção do raptor outra vez, chegando o mais perto possível. Mas dessa vez foi diferente. Quando emparelharam com ele, o raptor investiu rapidamente
contra elas. Sarah gritou e virou a moto, aumentando a distância outra vez.
- Filhos da mãe espertos - ela gritou. - Não dão uma segunda chance!
O raptor as perseguiu por alguns momentos e de repente mudou de direção na planície.
- Ele está indo para o rio! - Kelly gritou.
Sarah acelerou. A moto saltou para a frente.
- Qual a profundidade? Kelly não respondeu.
- Qual a profundidade?
- Eu não sei! - Kelly gritou. Estava tentando lembrar dos raptores atravessando o rio. Lembrou que eles estavam nadando. Isso queria dizer que devia ter no
mínimo...
- Mais de um metro? - Sarah perguntou. -Sim!
- Então não dá!
Estavam agora dez metros atrás do raptor e a distância aumentava. O animal entrou num pequeno bosque cerrado de cicadáceas.

Os troncos ásperos arranhavam Sarah e Kelly. O terreno era desigual, e a moto saltava loucamente.
- Não vejo nada! - Sarah gritou. - Segure firme!
Virou para a esquerda, na direção do rio, afastando-se do raptor. O animal estava desaparecendo na relva alta.
- O que está fazendo? - Kelly perguntou.
- Temos de cortar o caminho dele!
Com gritos agudos, um bando de pássaros levantou vôo na frente delas. Sarah continuou entre o tatalar das asas, e Kelly abaixou a cabeça. O rifle disparou.
- Cuidado! - Sarah gritou.
- O que aconteceu?
- O rifle disparou!
- Quantos tiros ainda tenho?
- Só mais dois! Veja se acerta!
O rio apareceu cintilando à luz da lua. Saíram da relva para a margem de lama. Sarah mudou de direção, a moto derrapou e caiu para o lado. Kelly caiu na lama
fria e Sarah caiu com todo o peso em cima dela. Sarah levantou imediatamente e correu para a moto, gritando:
- Vamos!
Atordoada, Kelly foi atrás dela. O rifle na sua mão estava cheio de lama. Imaginou se ia funcionar assim. Sarah já estava na moto, acelerando, fazendo sinal
para ela se apressar. Kelly saltou para a garupa e Sarah subiu a margem alta do rio.
O raptor estava vinte metros na frente delas, aproximando-se da água.
- Ele está fugindo!

O jipe de Thorne desceu a encosta aos saltos, descontrolado. As folhas das palmeiras batiam no pára-brisa, eles não viam nada mas sentiam a inclinação louca
da descida. O jipe deslizou de lado. Levine gritou.
Thorne segurou a direção com força, tentando endireitar o carro. Tocou com o pé no freio. O jipe virou para a frente e continuou a descida. Chegaram a uma
abertura entre as palmeiras. Thorne viu um campo de pedras negras que pareciam correr ao encontro deles. Os raptores corriam sobre as pedras. Mas talvez se ele fosse
pela esquerda...
- Não! - Levine gritou. - Não!
- Segure firme! - Thorne gritou, virando a direção para a esquerda.
O carro perdeu a tração e deslizou para baixo. O jipe bateu na pedra quebrando um dos faróis, derrapou de lado e continuou a descer. Thorne achou que tinha
quebrado a transmissão mas o carro continuava a descer, meio de lado, seguindo para a esquerda. O segundo farol bateu num galho e se quebrou. Continuaram a descer
no escuro, passaram por mais um grupo de palmeiras e de repente chegaram ao plano com um baque seco.
Os pneus do jipe rodaram na terra macia.
Thorne parou o carro.
Silêncio.
Olharam pelas janelas, tentando ver onde estavam. Mas estava muito escuro. Aparentemente era o fundo de um desfiladeiro, sob o dossel das copas das árvores.
- Contornos aluviais - disse Levine. - Devemos estar num leito seco de rio.
Quando seus olhos se ajustaram à escuridão, Thorne viu que Levine estava certo. Os raptores corriam para o centro do leito do rio protegido por grandes pedras
nos dois lados. Mas o leito do rio era arenoso e com largura suficiente para a passagem do jipe. Ele foi atrás dos animais.
- Tem idéia de onde estamos? - Levine perguntou, olhando para os raptores.
- Não.
O leito seco do rio ficou mais largo, abrindo-se numa bacia plana. As pedras desapareceram, substituídas por árvores, nos dois lados. Remendos de luar apareciam
aqui e ali, melhorando a visão.
Mas os raptores tinham desaparecido. Thorne parou o carro, abaixou o vidro e escutou. Ouvia os rosnados e os silvos. Pareciam vir da esquerda.
Thorne engatou a marcha e saiu do leito do rio, seguindo entre as samambaias e um ou outro pinheiro.
- Acha que o menino sobreviveu àquela descida? - Levine.
- Eu não sei. Nem imagino.
Ele seguiu devagar. Chegaram a uma abertura nas árvores e viram uma clareira com samambaias muito amassadas. Além da clareira viam as margens do rio com o
luar brilhando na água. De algum modo, tinham voltado para o rio.
Mas sua atenção estava toda na clareira. No vasto espaço aberto havia vários esqueletos de apatossauros. As costelas enormes, arcos de ossos descorados brilhavam
na luz prateada da lua. O vulto escuro de uma carcaça parcialmente devorada estava deitado de lado no centro da clareira, com nuvens de insetos zumbindo sobre ela.
- Que lugar é este? - disse Thorne. - Parece um cemitério.
- Sim - disse Levine. - Mas não é.
Os raptores estavam agrupados num lado da clareira, lutando sobre os restos do corpo de Eddie. Na outra extremidade havia três elevações baixas com as paredes
quebradas em vários lugares. Dentro dos ninhos eles viram pedaços de cascas de ovos. Era forte o cheiro de podridão.
Levine inclinou para a frente, observando com atenção.
- Este é o ninho dos raptores - ele disse.

No trailer escuro, Malcolm sentou com uma careta de dor. Apanhou o rádio.
- Você achou? O ninho?
- Sim - disse Levine. - Sim, acho que encontrei.
- Descreva - disse Malcolm.

Em voz baixa, Levine descreveu o que estava vendo, deu as dimensões estimadas. Para ele, o ninho do velocirraptor parecia sujo, malcuidado, malfeito. Isso
o surpreendia porque em geral os ninhos dos dinossauros davam sempre uma impressão de ordem. Levine tinha visto muitos deles nas várias escavações de Montana à Mongólia.
Os ovos eram dispostos em círculos concêntricos. Geralmente havia mais de trinta ovos num único ninho, sugerindo que várias fêmeas usavam o mesmo ninho. Sempre eram
encontrados numerosos restos fósseis de adultos perto das elevações de terra, indicando que todos os dinossauros tomavam conta dos ovos. Em algumas escavações era
possível ver determinada disposição espacial, com o ninho no centro, os adultos movendo-se cuidadosamente no lado de fora para não perturbar a incubação dos ovos.
Nessa estrutura rígida, os dinossauros lembravam seus descendentes, os pássaros, que também tinham um padrão definido para o namoro, o acasalamento e a construção
do ninho.
Mas os velocirraptores eram diferentes. A cena que estava vendo dava a impressão de uma desordem caótica. Ninhos malfeitos, adultos sempre brigando, poucos
animais jovens, as cascas dos ovos amassadas, as elevações de terra quebradas e com marcas de pés. Havia ossos espalhados em volta dos ninhos, que Levine supôs serem
os restos de raptores recém-nascidos. Não via nenhum filhote na clareira. Havia três animais jovens, mas tinham de se defender dos outros e já estavam cheios de
cicatrizes. Pareciam magros, subnutridos. Andavam na periferia da clareira, recuando sempre que um adulto os ameaçava, investindo com as mandíbulas abertas.
- E os apatossauros? - perguntou Malcolm. - O que me diz das carcaças?
Levine contou quatro ao todo. Em vários estágios de decomposição.
- Precisa dizer isso para Sarah - Malcolm disse.
Mas Levine já estava interessado em outra coisa. Imaginava como aquelas carcaças tinham ido parar ali. Os apatossauros não tinham morrido naquela clareira
por acidente. Sem dúvida eles evitavam aquele ninho. Não podiam ter sido atraídos para ali e eram grandes demais para ser carregados. Então, como chegaram à clareira?
Uma resposta óbvia, que ele não conseguia definir, desenhava-se no fundo de sua mente.
- Eles levaram Arby? - Malcolm perguntou.
- Sim - disse Levine. - Levaram.
Levine olhou para o ninho, tentando encontrar a resposta. Então Thorne chamou sua atenção.
- Lá está a gaiola. - Ele apontou para a outra extremidade da clareira.
Levine viu a gaiola no chão, meio escondida entre as folhagens. Percebiam o brilho das longarinas. Mas não viam Arby.
- Lá adiante - disse Levine.
Os raptores ignoravam a gaiola, brigando, disputando os restos de Eddie. Thorne apanhou o rifle Lindstradt e abriu o pente. Cinco dardos.
- Não é suficiente - ele disse. Havia pelo menos dez raptores na clareira.
Levine procurou a mochila no banco traseiro e a encontrou finalmente no chão do jipe. Tirou de dentro dela um cilindro prateado do tamanho de uma garrafa
de refrigerante, com um crânio e dois ossos no rótulo e as palavras: CUIDADO METACOLINA TÓXICA (MIVACURIUM).
- O que é isso? - perguntou Thorne.
- Uma coisa que eles inventaram em Los Alamos. E um neutralizador de área não-letal. Libera uma espécie de aerossol de colinesterase de curta ação.
- Mas e o garoto? - perguntou Thorne. - Não pode usar isso. Vai paralisá-lo.
Levine apontou para a clareira.
- Se atirarmos a lata à direita da gaiola, o gás vai para o outro lado, para longe dele, na direção dos raptores.
- Ou vai para cima dele - disse Thorne. - E ele pode estar gravemente ferido.
Levine fez um gesto afirmativo, guardou o cilindro na mochila e continuou a observar os raptores.
- Então, o que fazemos agora?
Thorne olhou para a gaiola de alumínio, parcialmente escondida pela folhagem. Então viu algo que o fez se inclinar para a frente, atento. A gaiola se moveu.
Ele via as barras brilhando ao luar.
- Viu aquilo? - Levine perguntou.
- Eu vou tirar aquele garoto de lá - Thorne disse.
- Mas como?
- Do modo antigo. Thorne saltou do carro.
Sarah acelerou e subiu com a moto na margem elevada do rio. O raptor estava logo à frente, correndo na diagonal, na direção delas, dirigindo-se para a água.
- Vá! - Kelly gritou. - Vá!
O raptor as viu e mudou de direção. Estava tentando se distanciar delas, mas a moto andava mais depressa do que ele na margem lamacenta. Chegaram ao lado
do animal, e Sarah deixou a margem alta, voltando para a planície. O raptor correu pela planície, afastando-se do rio.
- Você conseguiu! - Kelly gritou.
Sarah manteve a velocidade, movendo-se perto do raptor. O animal parecia ter desistido do rio e agora não tinha nenhum plano. Apenas corria ao acaso pela
planície. E elas ganhavam terreno, regular e inexoravelmente. Kelly estava entusiasmada. Começou a tirar a lama do rifle para atirar outra vez.
- Droga! - Sarah gritou.
- O que foi?
- Veja!
Kelly olhou por cima do ombro dela e viu bem na frente o bando de apatossauros. Estavam a cinqüenta metros do enorme animal mais próximo, que rugiu e girou
o corpo assustado. Os apatossauros eram verde-acinzentados à luz da lua.
O raptor correu diretamente para o bando.
- Acho que vamos perdê-lo! - Sarah acelerou, chegando mais perto. - Acerte agora! Agora!
Kelly apontou e atirou. A arma saltou em sua mão. Mas o raptor continuou a correr.
- Errei!
Um pouco adiante, os apatossauros estavam tentando fugir, os pés enormes estremecendo o solo, as caudas compridas chicotean-do o ar. Mas eram lentos demais
para fugir. O raptor correu para debaixo dos grandes animais.
- O que vamos fazer? - Kelly gritou.
- Não temos escolha! - respondeu Sarah.
Estavam correndo agora com a moto paralela ao raptor, debaixo do primeiro apatossauro. Kelly viu a curva da barriga do animal um metro acima da sua cabeça.
As pernas eram grossas como troncos de árvores, movendo-se freneticamente, os pés batendo no chão.
O raptor correu agilmente entre as pernas enormes. Sarah foi atrás dele, desviando. Acima deles os apatossauros rugiam e giravam o corpo e rugiam outra vez.
Estavam debaixo de outra barriga, depois a céu aberto ao luar, depois à sombra outra vez. Agora estavam no meio do bando. Era como uma floresta de árvores móveis.
Logo à frente, uma perna imensa desceu com um bangl que estremeceu a terra. A moto saltou quando Sarah desviou rapidamente para a esquerda para não serem
esmagadas pelo animal. O raptor deu uma guinada, girou o corpo e saiu do meio do bando.
- Droga! - Sarah disse, virando a moto rapidamente. Uma cauda comprida chicoteou o ar, quase as atingindo, e então estavam livres, outra vez perseguindo o
raptor.
A moto voava na planície.
- Última chance! - Sarah gritou. - Acerte agora!
Kelly ergueu o rifle. Sarah acelerou, chegando muito perto do raptor. O animal virou a cabeça para atacá-la, mas ela manteve a posição e desfechou um soco
violento no focinho do animal.
- Agora!
Kelly encostou o cano do rifle no pescoço do raptor e apertou o gatilho. A arma saltou para trás com violência, batendo no estômago dela.
O raptor continuou a correr.
- Não! - Kelly gritou. - Não!
Então, de repente, o raptor caiu na relva alta e Sarah parou a moto. O raptor estava a cinco metros delas, caído na relva, rosnando e ganindo. Depois silenciou.
Sarah apanhou o rifle e abriu o pente de munição. Kelly viu mais cinco dardos.
- Pensei que fosse o último - ela disse.
- Eu menti. Espere aqui.
Kelly ficou na moto enquanto Sarah se adiantou cautelosamente entre a relva alta. Ela deu mais um tiro e esperou, para ver se o animal se movia. Então abaixou
ao lado dele.
Quando voltou, Sarah tinha na mão a chave da gaiola.

No ninho, os raptores estavam ainda em cima da carcaça, num dos lados da clareira. Mas sem a intensidade feroz do começo. Alguns começavam a se afastar, passando
as patas nos focinhos, dirigindo-se lentamente para o centro da clareira.
Aproximando-se da gaiola.
Thorne subiu na traseira do jipe e tirou a coberta de lona. Examinou o rifle.
Levine passou para o banco do motorista e ligou o motor. Thorne se firmou na traseira, segurando a barra de ferro, e disse para Levine.
-Vá!
O jipe entrou a toda velocidade na clareira. Ao lado da carcaça, os raptores olharam surpresos. Mas então o jipe estava além do centro da clareira, passou
pelos esqueletos enormes, as costelas altas, acima das cabeças dos dois homens. Levine virou o carro e parou ao lado da gaiola de alumínio. Thorne saltou e segurou
a gaiola com as duas mãos. No escuro, ele não podia dizer se Arby estava gravemente ferido ou não. O menino estava deitado de bruços. Levine desceu do carro, Thorne
gritou para ele voltar e, erguendo a gaiola a jogou na parte traseira do jipe. Thorne saltou para onde estava a gaiola e Levine deu a partida. Atrás deles, os raptores
rosnaram e começaram a perseguição, correndo entre os enormes esqueletos. Atravessaram a clareira numa velocidade espantosa.
Levine acelerou e um raptor saltou sobre a traseira do carro apanhando a lona entre os dentes. Sibilando furioso, o animal não largou a lona.
Levine acelerou ao máximo e eles saíram da clareira.

No escuro, Malcolm voltou aos seus sonhos de morfina. Imagens flutuavam na frente dos seus olhos, paisagens aptas, o computador usado para pensar sobre a
evolução. No mundo matemático de picos e vales, populações de organismos subiam os picos da aptidão ou deslizavam para os vales da não-adaptação. Stu Kauffman e
seus colaboradores haviam provado que os organismos avançados possuem restrições internas complexas que os tornam menos aptos a descer do ponto ótimo de aptidão
para os vales. Contudo, ao mesmo tempo, as criaturas complexas são selecionadas pela evolução, porque essas criaturas complexas são capazes de realizar a própria
adaptação. Com instrumentos, com aprendizado, com cooperação.
Mas os animais complexos teriam obtido sua flexibilidade de adaptação a um preço mais alto - trocaram uma dependência por outra. Não era necessário mudar
seus corpos para se adaptar porque agora sua adaptação era comportamental e socialmente determinada. O comportamento exigia aprendizado. Em certo sentido, entre
os animais superiores a aptidão adaptativa já não seria transmitida para a geração seguinte pelo DNA. Seu portador era o ensino. Os chimpanzés ensinavam seus filhos
a apanhar cupins com um graveto. Esse ato implica, no mínimo, certos rudimentos de cultura, uma vida social estruturada. Mas os animais que crescem isolados, sem
pais, sem orientação, não seriam completamente funcionais. Os animais dos zoológicos geralmente não podem tomar conta das crias porque nunca viram como isso é feito.
Eles ignoram os filhotes, rolam em cima deles, amassando-os, ou simplesmente os matam porque os incomodam demais.
Os velocirraptores pertenciam a uma das espécies mais inteligentes de dinossauros e uma das mais ferozes. Essas duas características exigem controle de comportamento.
Milhões de anos atrás, no Cretáceo, agora desaparecido, seu comportamento foi socialmente determinado, passado dos animais mais velhos para os mais novos. Os genes
controlavam a capacidade de criar esses padrões, mas não os próprios padrões. O comportamento adaptativo era uma espécie de moralidade, era comportamento evoluído
através de muitas gerações porque a experiência provou sua eficácia - comportamento que permitia aos membros das espécies cooperar, viver em grupo, caçar, criar
os filhos.
Mas naquela ilha os velocirraptores foram recriados num laboratório de genética. Embora seus corpos físicos fossem geneticamente determinados, seu comportamento
não era. Os raptores criados desse modo chegaram ao mundo sem animais mais velhos para orientá-los, para mostrar o comportamento adequado do raptor. Estavam sozinhos
e era assim que se comportavam - numa sociedade sem estrutura, sem regras, sem cooperação. Viviam num mundo sem controle, onde era cada um por si, onde o mais cruel
e mais ousado sobrevivia e todos os outros morriam.

O jipe corria, saltando loucamente. Thorne segurava nas barras laterais para não ser jogado para fora. Atrás dele, o raptor balançava violentamente no ar,
com as mandíbulas fechadas na ponta da lona. Levine voltou para a margem lamacenta e virou para a direita, seguindo o rio. O raptor não largava a lona.
Logo adiante, Levine viu outro esqueleto na lama. Outro esqueleto? Por que havia tantos esqueletos naquela área? Mas não tinha tempo para pensar - seguiu
em frente, passando debaixo da fileira de costelas enormes. Sem os faróis, ele dirigia inclinado para a frente, aproveitando a luz da lua, atento aos obstáculos
do caminho.
Na traseira do carro, o raptor ergueu o corpo com um impulso, soltou a lona, fechou as mandíbulas em volta de uma das barras e começou a puxar a gaiola para
fora do jipe. Thorne saltou para a frente e segurou o outro lado da gaiola. A gaiola girou rapidamente, e Thorne caiu de costas. Começou então um cabo-de-guerra
com o raptor - e o raptor estava ganhando. Thorne passou a perna em volta do banco do passageiro para se firmar melhor. O raptor rosnou. Thorne sentia a fúria louca
do animal vendo a possibilidade de perder a presa.
- Tome! - Levine passou a arma para Thorne.
Thorne estava deitado de costas, segurando a gaiola com as duas mãos. Não podia segurar a arma. Levine olhou para trás, viu a situação e depois olhou pelo
retrovisor. O resto do grupo ainda os perseguia, rosnando e urrando. Não podia diminuir a marcha. Thorne não podia largar a gaiola. Mantendo a velocidade, Levine
virou para trás e apontou a arma. Tentou ajeitar o rifle, sabendo o que aconteceria se atirasse acidentalmente em Thorne ou em Arby.
- Cuidado! - gritou Thorne. - Cuidado!
Levine conseguiu soltar o pino de segurança e apontou a arma diretamente para o raptor que continuava com a barra da gaiola entre os dentes. O animal ergueu
os olhos e com um movimento rápido soltou a barra da gaiola e mordeu o cano da arma, puxando com força.
Levine atirou.
O raptor arregalou os olhos quando o dardo atingiu a parte posterior da sua garganta. Com um gorgolejo áspero, entrou em convulsão e caiu para trás, para
fora do jipe - na queda arrancando o rifle das mãos de Levine.
Thorne ajoelhou rapidamente e puxou a jaula para dentro do jipe. Olhou para Arby, mas era difícil saber como ele estava. Olhou para trás. O bando de raptores
ainda os perseguia, mas agora estava a vinte metros e a distância aumentava.
A voz de Sarah soou no rádio do painel do jipe.
- Thorne.
- Sim, Sarah.
- Onde vocês estão?
- Seguindo o rio.
As nuvens de chuva tinham desaparecido, e a noite estava clara, enluarada. Atrás deles os raptores continuavam a perseguir o jipe. Mas cada vez ficavam mais
longe.
- Não vejo as luzes do jipe - Sarah disse.
- Não temos nenhuma luz.
Uma pausa, estática, e ela perguntou, com voz tensa:
- E Arby?
- Está conosco - disse Thorne.
- Graças a Deus. Como ele está?
- Eu não sei. Vivo.
A paisagem se abriu na frente deles. Estavam num vale muito amplo, com a relva brilhando prateada ao luar. Thorne olhou em volta, procurando se orientar.
Logo compreendeu, estavam de volta à planície, mas bem mais ao sul. Nesse caso poderiam seguir pela estrada do penhasco, que ficava em algum ponto à esquerda. A
estrada os levaria à clareira e ao segundo trailer. E à segurança. Ele bateu nas costas de Levine e apontou para a direita.
- Por ali.
Levine obedeceu, e Thorne ligou o rádio.
- Sarah.
- Sim.
- Estamos voltando para o trailer pela estrada do penhasco.
- Tudo bem - ela disse. - Vamos encontrá-los.
Sarah olhou para trás, para Kelly.
- Onde fica a estrada do penhasco?
- Acho que é aquela lá em cima. - Apontou para a parte mais alta do penhasco.
- Tudo bem - Sarah disse, acelerando a moto.
O jipe seguiu pela planície, entre a relva alta. Estavam indo depressa, já não viam os raptores.
- Parece que os deixamos para trás - Thorne disse.
- Talvez - disse Levine. Ao sair do leito seco do rio, ele tinha visto vários animais correndo para a esquerda. Deviam estar escondidos na relva. Levine não
acreditava que eles fossem desistir tão facilmente.
O jipe corria para o penhasco. Logo adiante Levine viu uma estrada que subia do vale, íngreme e cheia de curvas. Era a estrada do penhasco com certeza.

Agora que o jipe não saltava tanto, Thorne passou entre os dois bancos e se agachou perto da gaiola. Arby gemia baixinho.
Metade do rosto do menino e sua camisa estavam cheias de sangue. Mas os plhos estavam abertos, e ele parecia poder mover os braços e as pernas.
Thorne chegou bem perto das barras.
- Ei, filho - ele disse suavemente. - Pode me ouvir? Arby fez que sim com a cabeça e gemeu.
- Como estão as coisas aí dentro?
- Já estive em lugares melhores - disse Arby.

O jipe entrou na estrada de terra e começou a subir a encosta íngreme em ziguezague. A medida que subiam, afastando-se do vale, Levine ficava mais aliviado.
Estavam finalmente na estrada do penhasco e logo estariam a salvo.
Olhou para cirna, para o alto, e à luz da lua viu os vultos escuros, no topo da subida, saltando freneticamente. Raptores. Esperando por ele. Levine parou
o jipe.
- O que fazemos agora?
- Chegue para o lado - Thorne disse. - Daqui para a frente eu dirijo.

NO LIMITE DO CAOS


Thorne chegou ao topo e acelerou, virando para a esquerda. A estrada estendia-se à sua frente, iluminada pelo luar, uma faixa estreita com penhascos altos
à esquerda e o precipício à direita. Os raptores estavam vinte metros acima deles, saltando e bufando, correndo paralelo ao jipe. Levine os viu também.
- O que vamos fazer? - ele perguntou. Thorne balançou cabeça.
- Procure naquela caixa de ferramentas, no porta-luvas. Apanhe o que encontrar.
Levine se inclinou para a frente, procurando no escuro. Mas Thorne sabia que estavam em apuros. Não tinham a arma. Estavam num jipe com capota de lona, rodeado
por raptores. Calculou que deviam estar a uns oitocentos metros da clareira e do trailer.
Oitocentos metros ainda.
Thorne diminuiu a marcha na curva seguinte, afastando o carro do abismo à direita. Logo depois da curva, viu um raptor agachado no meio da estrada, de frente
para eles, com a cabeça ameaçadora-mente abaixada, pronto para o ataque. Thorne acelerou para cima dele. O raptor saltou no ar e caiu sobre o capo do jipe, as garras
raspando o metal. Bateu no pára-brisa, e o vidro se transformou numa teia. Com o corpo do animal encostado no pára-brisa, Thorne não via nada. A estrada era perigosa
e ele freou bruscamente.
- Ei! - Levine gritou, caindo para a frente.
O raptor deslizou para o lado do capo. Agora Thorne podia ver a estrada e pisou fundo no acelerador. Levine caiu para trás quando o carro arrancou. Mas três
raptores atacavam a lateral do jipe.
Um saltou e abocanhou o espelho lateral. O olho do animal estava perto do rosto de Thorne. Ele virou bruscamente para a esquerda, raspando o jipe na pedra.
Dez metros à frente ele viu uma pedra alta. Thorne olhou para o raptor que continuava tenazmente seguro ao espelho pelos dentes, no momento em que o espelho bateu
na pedra, jogando o animal para longe. O raptor desapareceu.
A estrada agora era um pouco mais larga. Thorne tinha mais espaço para manobrar. Ouviu um baque surdo e pesado, e a capota de lona desceu sobre sua cabeça.
Garras afiadas rasgaram a lona e passaram a poucos centímetros da sua orelha. Levine ergueu uma faca enorme de caça e a enfiou na lona. Imediatamente outra garra
desceu, ferindo sua mão. Levine gritou de dor e deixou cair a faca. Thorne a apanhou do chão.
Pelo retrovisor ele viu mais dois raptores na estrada, perseguindo o jipe. Estavam chegando perto.
Mas a estrada era mais larga agora e Thorne acelerou. O raptor na capota espiou para dentro pelo pára-brisa quebrado. Thorne ergueu a faca e atacou com toda
a força, uma, duas vezes. Aparentemente não fez a menor diferença. Quando entrou numa curva, ele jogou a direção para a direita, depois para a esquerda, o jipe saltou
e o raptor na capota rolou para trás. Na queda ele levou mais da metade da capota de lona. O animal caiu em cima dos dois outros raptores que perseguiam o jipe.
O impacto lançou os três para o lado e eles despencaram no abismo.
- Acabou! - gritou Levine.
Mas logo depois, outro raptor saltou do penhasco e correu para a frente, a poucos metros do jipe.
E agilmente, quase com facilidade, o raptor saltou para a traseira do carro.
Levine, no banco do passageiro, olhou assustado para trás. O raptor estava dentro do jipe, com a cabeça abaixada, os braços erguidos, a boca escancarada,
numa posição de ataque. O raptor rosnou para ele.
Levine pensou: É o fim.
Paralisado pelo choque, Levine suava profusamente, atordoado, e num instante compreendeu que não podia fazer nada, que estava a poucos segundos da morte.
A criatura rosnou outra vez, abrindo e fechando a boca, agachando para o salto - e então, de repente, uma espuma branca apareceu nos cantos da sua boca e ele revirou
os olhos. Começou a se contorcer numa convulsão e caiu de lado na parte de trás do carro.
Então Levine viu Sarah na moto, atrás deles, e Kelly com o rifle. Thorne diminuiu a marcha e esperou que Sarah os alcançasse. Ela estendeu a chave para Levine.
- Para a gaiola! - ela gritou.
Levine, ainda atordoado, quase deixou cair a chave. Estava em choque. Seus movimentos eram lentos. Eu quase morri, pensou.
- Apanhe a arma dela! - Thorne disse.
Levine olhou para a esquerda, onde os raptores corriam ainda eu paralelo com o carro. Ele contou seis, mas provavelmente havia mais. Tentou contar outra vez,
sua mente em câmara lenta...
- Apanhe essa droga de rifle!
Levine apanhou a arma de Kelly, sentindo o frio do metal nas mãos.
Então o carro começou a falhar, tossindo, andando aos trancos.
- O que é isso? - Levine perguntou.
- Encrenca - Thorne respondeu. - Estamos sem gasolina.
Thorne pôs o carro em ponto morto e o jipe seguiu em frente, perdendo velocidade. Logo adiante havia uma subida e, depois da curva, ele viu que a estrada
descia outra vez. Sarah, na moto, atrás deles, balançou a cabeça.
Thorne compreendeu que a única esperança era chegar ao alto da subida.
- Abra a gaiola - ele disse para Levine. - Tire o menino de lá-.
De repente, Levine começou a se mover depressa, quase em pânico. Arrastando-se, foi até a gaiola, abriu a porta e ajudou Arby a sair.
Thorne via o ponteiro do velocímetro caindo cada vez mais. Estavam a quarenta quilômetros... depois trinta... depois vinte. Os raptores, correndo ao lado
do jipe, começaram a se aproximar, percebendo que o carro estava com problemas.
Vinte quilômetros e o ponteiro caindo.
- Ele está fora - Levine disse, fechando a porta da gaiola.
- Empurre a gaiola para fora do carro - Thorne disse.
A gaiola caiu e rolou na descida.
Quinze quilômetros.
O carro estava se arrastando.
Então chegaram ao alto da subida e começaram a descer. O jipe ganhou velocidade. Dezenove quilômetros por hora. Vinte. Trinta. Thorne fazia as curvas tentando
não usar o freio.
- Nunca chegaremos ao trailer - Levine disse, gritando a plenos pulmões, os olhos arregalados de medo.
- Eu sei. - Thorne via o trailer à esquerda, mas depois de uma pequena subida. Não conseguiriam chegar até lá. Mas logo adiante a estrada se dividia, um dos
braços descendo para o laboratório. E, se não estava enganado, aquela estrada era toda em declive.
Thorne virou para a direita, afastando-se do trailer.
Ele viu o telhado grande do laboratório, como uma chapa extensa ao luar. Seguiu pela estrada, passou pelo laboratório e deu a volta por trás, seguindo na
direção da área residencial dos trabalhadores. Viu a casa do administrador à direita e a loja de conveniência com a bomba de gasolina na frente. Talvez tivessem
deixado um pouco de gasolina.
- Veja! - Levine apontou para trás. - Veja! Veja! Thorne olhou para trás e viu os raptores voltando, continuando a perseguição. Quando chegaram perto do laboratório,
pareceram hesitar.
- Não estão nos seguindo! - Levine gritou.
- É - disse Thorne. - Mas onde está Sarah? Não viam a moto de Sarah em parte alguma.

O TRAILER


Sarah Harding girou os aceleradores e a moto começou a subir a pequena elevação. Chegou ao topo e desceu, na direção do trailer. Os raptores corriam atrás
delas, rosnando. Sarah acelerou, tentando se distanciar mais, ganhar mais alguns metros preciosos. Porque iam precisar.
Inclinou-se para trás e gritou para Kelly:
- Tudo bem! Isto tem de ser rápido!
- O quê? - gritou Kelly.
- Assim que chegarmos ao trailer, você salta e corre. Compreendeu?
Kelly balançou a cabeça, tensa.
- O que quero dizer é que não espere por mim!
- Tudo bem.
Sarah chegou perto do trailer e freou bruscamente. A moto derrapou na relva molhada e bateu na lateral do trailer. Mas Kelly já tinha saltado. Correu para
a porta e entrou. A vontade de Sarah era entrar com a moto, mas viu que os raptores estavam muito perto, perto demais. Empurrou a moto contra eles e, com um único
movimento, saltou, atirou-se contra a porta e caiu de costas dentro do trailer. Girou o corpo e fechou a porta com os pés no momento exato em que um dos raptores
se lançou contra ela.
Dentro do trailer escuro, ela apoiou o peso do corpo na porta enquanto o raptor a atacava com golpes seguidos. Procurou uma fechadura mas não encontrou.
- Ian, esta porta não tem fechadura?
Ouviu a voz de Malcolm, sonolenta no escuro.
- A vida é um cristal - ele disse.
- Ian. Procure prestar atenção.
Agora Kelly estava ao lado dela movendo as mãos para cima e para baixo. Os raptores batiam sem cessar. Depois de um momento, Kelly disse.
- É aqui embaixo. Perto do assoalho. Harding ouviu o clique metálico e se afastou da porta. Kelly segurou a mão dela.
Os raptores batiam e rosnavam lá fora.
- Vou ficar bem - Sarah disse, aproximando-se de Malcolm que estava ainda deitado na cama.
Os raptores atacavam agora a janela perto da cabeça dele, arranhando o vidro com as garras. Malcolm olhava para eles calmamente.
- Filhos da mãe barulhentos, não são?
A caixa de primeiros-socorros estava aberta ao lado dele e havia uma seringa sobre a almofada da cama. Provavelmente Malcolm tinha tomado outra dose de morfina.
Os animais pararam de se atirar contra os vidros. Sarah ouviu o som de metal arranhado e viu que os raptores estavam levando a moto para longe do trailer,
saltando sobre ela furiosos. Logo iam furar os pneus.
- Ian - ela disse. - Precisamos fazer isto depressa.
- Não tenho pressa - ele disse calmamente.
- Que armas você tem aqui?
- Armas... oh... eu não sei... - Malcolm suspirou. - Para que você quer armas?
- Ian, por favor.
- Você está falando tão depressa. Sarah, eu acho que você precisa relaxar.
Kelly estava muito assustada no trailer escuro, mas o modo decidido com que Sarah falou nas armas a tranqüilizou um pouco. Ela começava a compreender que
Sarah não permitia que nada a impedisse, ela seguia em frente e fazia o que devia ser feito. Essa atitude de não deixar que ninguém a impedisse de agir, de acreditar
que ela podia fazer o que queria, era algo que Kelly achava digno de ser imitado.
Ouvindo a voz de Malcolm, ela compreendeu que ele não ia ajudar em nada. Estava drogado e pouco se importava com o que pudesse acontecer. E Sarah parecia
não conhecer o interior do trailer. Kelly conhecia. Tinha revistado o segundo trailer antes, à procura de comida. E lembrava vagamente...
No escuro, ela começou a abrir as gavetas rapidamente. Tinha certeza de ter visto numa delas um embrulho com um crânio e dois ossos cruzados. Podia ser uma
espécie de arma, ela pensou.
Ouviu Sarah dizer.
- Ian, procure pensar.
E o Dr. Malcolm respondeu:
- Oh, eu estive pensando, Sarah. Tive os pensamentos mais maravilhosos. Todas aquelas carcaças no local do ninho dos raptores são um exemplo maravilhoso...
- Agora não, Ian.
Kelly continuou a procurar no escuro, deixando as gavetas abertas para saber quais já havia examinado. De repente tocou numa lona áspera e se inclinou para
a frente. Sim, era isso.
Tirou da gaveta um pacote de lona surpreendentemente pesado e disse:
- Sarah, veja.

Sarah levou o pacote para perto da janela aonde chegava a luz da lua. Abriu e examinou o conteúdo. O pacote era dividido em partes acolchoadas. Sarah viu
três blocos quadrados que pareciam feitos de borracha. Havia também um pequeno cilindro como uma garrafa de oxigênio.
- O que é isto?
- Achamos que seria uma boa idéia - disse Malcolm. - Mas não tenho muita certeza. O caso é que...
- O que é? - Sarah interrompeu. Ela se esforçava para pensar. Sua mente estava fora de controle.
- Não-letal - Malcolm disse. - Uma banda de ragtime... Nós queríamos ter...

- O que é isto? - Sarah perguntou, segurando o pacote na frente do rosto dele.
- Cubo de fumaça para dispersar a área. O que tem a fazer é...
- Só fumaça? - Sarah perguntou. - Só faz fumaça?
- Sim, mas...
- O que é isto? - Sarah levantou o cilindro prateado com alguma coisa escrita.
- Bomba de colinesterase. Solta gás. Produz paralisia de curta duração quando explode. Pelo menos é o que dizem.
- Quanto tempo?
- Alguns minutos, eu acho, mas...
- Como funciona? - ela perguntou, girando o cilindro na mão. Viu uma capa na extremidade com um pino. Começou a puxar o pino para examinar o mecanismo.
- Não faça isso! - ele disse. - Você puxa o pino e atira. Explode em poucos segundos.
- Tudo bem. - Apressadamente ela arrumou a caixa de primeiros-socorros, guardando também a seringa.
- O que você está fazendo? - Malcolm perguntou, alarmado.
- Vamos sair daqui - Sarah disse, caminhando para a porta.
- É tão bom ter um homem em casa - Malcolm disse com um suspiro.

O cilindro voou alto, rolando ao luar. Os raptores estavam a uns cinco metros do trailer, amontoados em volta da moto. Um deles olhou para
cima e viu o cilindro que caiu na relva a poucos metros deles.
Na porta, Sarah esperou.
Nada aconteceu.
Nenhuma explosão.
Nada.
- Ian! Não funcionou!
Um raptor curioso saltou até onde o cilindro tinha caído.
Abaixou a cabeça e quando a levantou estava com o cilindro na boca.
Sarah suspirou.
- Não funcionou.
- Oh, não faz mal - Malcolm disse com toda a calma. O raptor balançou a cabeça mordendo o cilindro.
- O que fazemos agora? - Kelly perguntou.
Ouviram uma explosão e uma nuvem densa de fumaça branca se espalhou na clareira. Os raptores desapareceram na fumaça. Sarah fechou a porta rapidamente.
-E agora? - perguntou Kelly.
Com Malcolm apoiado no ombro de Sarah, eles começaram a atravessar a clareira. A nuvem de gás tinha dissipado há alguns minutos. O primeiro raptor que encontraram
estava deitado de lado, olhos abertos, completamente imóvel. Mas não estava morto. Sarah via a pulsação no pescoço do animal. Só estava paralisado.
- Quanto tempo dura? - ela perguntou para Malcolm.
- Não tenho idéia. Há muito vento?
- Nenhum, Ian.
- Então deve durar um pouco.
Seguiram pela clareira no meio dos raptores paralisados, desviando dos carnívoros que cheiravam a carne podre. Um deles estava deitado em cima da moto. Sarah
pôs Malcolm no chão.e ele sentou com um suspiro, depois começou a cantar.
Sarah puxou a moto pelo guidom, tentando tirá-la debaixo do raptor. Mas o animal era pesado demais. Kelly disse.
- Deixe-me ajudar. - E segurou o guidom.
Sarah, sem hesitar, passou os braços em volta do pescoço do animal e puxou a cabeça para cima. Sentiu uma onda de náusea. A pele quente e áspera arranhou
seus braços e seu rosto. Ela inclinou o corpo para trás, levantando o raptor.
- Conseguiu? - Sarah perguntou para Kelly.
- Ainda não - disse Kelly, puxando a moto.
O rosto de Sarah estava a centímetros do focinho do raptor. A cabeça do animal balançou para frente e para trás quando ela ajeitou os braços. O olho aberto
olhava para ela, sem ver. Com esforço, ela tentou levantar mais o corpo pesado.
- Quase - Kelly disse.
Sarah gemeu e levantou mais um pouco. O olho piscou.
Assustada, Sarah largou o animal. Kelly puxou a moto.
- Tirei!
Sarah passou para o outro lado do raptor. Uma das pernas mexeu. O peito começou a se mover.
- Vamos embora - Sarah disse. - Ian, atrás de mim. Kelly, no guidom.
- Vamos embora - Sarah disse, subindo na moto, sem tirar os olhos do raptor. Acabeça fez um movimento convulsivo. O olho piscou outra vez. Ele estava acordando.
- Vamos, vamos. Vamos!

A VILA DOS TRABALHADORES


A moto desceu a colina, na direção das casas dos trabalhadores. Olhando por cima do ombro de Kelly, ela viu o jipe parado na frente da loja, perto das bombas
de gasolina. Ela parou e os três desceram. Kelly abriu a porta da loja e ajudou Malcolm a entrar. Sarah entrou com a moto e fechou a porta.
- Thorne? - ela chamou.
- Estamos aqui - disse Thorne. - Com Arby.
A luz da lua que entrava pelas janelas, Sarah viu que a loja parecia uma loja de conveniência de beira de estrada, abandonada. Havia uma geladeira com porta
de vidro para refrigerantes, as latas obscurecidas pelo mofo na porta. Numa estante giratória estavam barras de chocolate e balas com o papel manchado de verde,
cheios de larvas. As revistas na outra estante estavam com as páginas enroladas e manchetes de cinco anos atrás.
De um lado ficava a estante de suprimentos básicos, pasta de dentes, aspirina, bronzeador, xampu, pentes e escovas. Ao lado ficava a prateleira de roupas,
camisetas e shorts, meias, raquetes de tênis, roupas de banho. E algumas lembranças da ilha, chaveiros, cinzeiros e copos.
No centro da sala havia uma pequena ilha com caixa registradora computadorizada, um microondas e uma máquina de fazer café. A porta do microondas estava aberta.
Algum animal havia feito ninho dentro do forno. A máquina de fazer café estava rachada e cheia de teias de aranha.
- Que bagunça - Malcolm disse.
- Para mim parece ótimo - disse Sarah.
Todas as janelas tinham barras de ferro. As paredes pareciam muito sólidas. Os alimentos enlatados ainda deviam servir. Ela viu a tabuleta que dizia "Banheiros".
Talvez os encanamentos ainda estivessem funcionando. Estariam seguros ali, pelo menos por algum tempo.
Sarah ajudou Malcolm a deitar no chão e depois foi para onde Thorne e Levine tratavam de Arby.
- Eu trouxe a caixa de primeiros-socorros - ela disse. - Como está ele?
- Bastante machucado - Thorne disse. - Alguns cortes. Mas nada quebrado. A cabeça não está muito boa.
- Tudo dói - Arby disse. - Até a boca.
- Alguém veja se temos luz - Sarah disse. - Deixe-me ver, Arby. Tudo bem, faltam alguns dentes, por isso está doendo. Mas isso pode ser consertado. O corte
na cabeça não é tão grave. - Ela limpou com gaze e disse para Thorne: - Quanto tempo falta para o helicóptero chegar?
Thorne consultou o relógio.
- Duas horas.
- E onde ele vai pousar?
- A alguns quilômetros daqui. Continuando a tratar de Arby, ela disse:
- Tudo bem. Então temos duas horas para chegar lá.
- Como? - Kelly disse. - O carro está sem gasolina.
- Não se preocupe - disse Sarah. - Pensaremos em alguma coisa. Tudo vai dar certo.
- Você sempre diz isso.
- Porque sempre é verdade - disse Sarah. - Muito bem, Arby, agora preciso da sua ajuda. Vou ajudá-lo a sentar e você vai tirar a camisa...

Thorne se afastou para um lado com Levine, que estava arregalado de medo e movendo-se de modo meio convulsivo. Ao que parecia, a viagem de jipe tinha acabado
com ele.
- De que ela está falando? - Levine disse, histérico. - Estamos encurralados aqui. Encurralados! Não podemos ir a lugar algum. Não podemos fazer nada. Ouça
o que estou dizendo, vamos todos m...
- Fale baixo - Thorne segurou o braço dele com força. - Não assuste os meninos.
- Que diferença faz? Eles vão saber, cedo ou... Ai! Vá com calma.
Apertando com força o braço de Levine, Thorne se inclinou para ele.
- Você está velho demais para agir como um cretino - ele disse, em voz baixa. - Agora, trate de se controlar, Richard. Está ouvindo, Richard?
Levine fez que sim com a cabeça.
- Ótimo. Agora, Richard, eu vou sair para ver se as bombas de gasolina estão funcionando.
- Não podem estar. Não depois de cinco anos. Estou dizendo, é perda de...
- Richard. Precisamos verificar as bombas de gasolina. Os dois homens se entreolharam por um momento.
- Está dizendo que vai sair daqui? - perguntou Levine. ; - Isso mesmo.
Levine pensou por um momento. Outra pausa. Agachada ao lado de Arby, Sarah disse:
- Ei, vocês dois, onde está a luz?
- Um minuto - Thorne respondeu e depois disse para Levine: - Está bem?
- Está bem. - Levine respirou fundo.
Thorne abriu a porta e saiu para a noite escura. Levine fechou a porta. Thorne ouviu o estalo da fechadura.
Voltou imediatamente e bateu de leve. Levine abriu muito pouco e olhou para fora.
- Pelo amor de Deus - murmurou Thorne. - Não tranque a porta!
- Mas eu pensei...
- Não tranque essa maldita porta!
- Tudo bem, tudo bem. Desculpe.
- Era só o que faltava! - Thorne disse, zangado.
Fechou a porta e virou-se para enfrentar a noite.
A única coisa que Thorne ouvia era o canto das cigarras no escuro. Parecia quieto demais, ele pensou. Mas talvez fosse o contraste com os rosnados dos raptores.
Ficou por um longo tempo parado, de costas para a porta, olhando para a clareira. Não via nada.
Finalmente foi até o jipe, abriu a porta e, no escuro, procurou o rádio. Estava debaixo do banco. Thorne o apanhou, voltou para a loja e bateu na porta.
Levine abriu e disse:
- Não está tran...
- Fique com isso - Thorne disse, entregando o rádio e fechando a porta.
Parou outra vez no escuro. Tudo era silêncio. Era noite de lua cheia. O ar estava parado.
Deu alguns passos e examinou as bombas de gasolina. A alça de uma delas estava enferrujada e cheia de teias de aranha. Ele retirou a mangueira e apertou a
alavanca. Não aconteceu nada. Apertou a mangueira. Nada. Bateu no vidro que mostrava o número de litros e o vidro caiu na sua mão. Uma aranha correu entre os números
de metal.
Não tinham gasolina.
Precisava encontrar gasolina, do contrário nunca chegariam ao helicóptero. Thorne pensou por um momento, olhando para as bombas. Eram simples, do tipo que
se encontra nos lugares remotos. E isso fazia sentido porque, afinal, aquilo era uma ilha.
Sim, era uma ilha. O que significava que tudo chegava de avião ou de barco. Provavelmente, na maior parte das vezes de barco. Barcos pequenos que traziam
suprimentos. O que significava...
Thorne examinou a base da bomba. Exatamente como tinha pensado. Não havia depósito de gasolina sob o solo. Viu um cano de PVC grosso e preto que fazia um
ângulo, sob o solo, e ia para o lado da loja.
Thorne acompanhou o cano, movendo-se cautelosamente à luz da lua. Parou por um momento para escutar e continuou.
Chegou ao lado da loja e encontrou o que esperava, três tambores de metal de vinte litros, enfileirados junto à parede, ligados por uma série de mangueiras
pretas. Também fazia sentido. Toda a gasolina da ilha tinha de vir em tambores.
Bateu nos tambores com a mão fechada. Estavam vazios. Levantou um, esperando ouvir o líquido balançar lá dentro. Eles não iam precisar de mais que uns cinco
litros...
Nada.
Mas certamente, ele pensou, devia haver mais de três tambores. Fez um cálculo rápido. Um laboratório daquele tamanho devia ter uma meia dúzia de veículos,
talvez mais. Mesmo que tivessem grande autonomia, deviam gastar no mínimo cem litros por semana. Por segurança, a empresa devia armazenar suprimento pelo menos para
dois meses, talvez seis meses.
Isso queria dizer trinta tambores. E tambores de aço eram pesados, portanto deviam ser guardados perto das bombas. Talvez a alguns metros...
Thorne girou o corpo devagar, procurando. Ele via bem à luz da lua.
Além da loja havia um espaço aberto e depois uma pequena moita de rododendros que agora cobriam o caminho para à quadra de tênis. Acima dos arbustos, a cerca
de metal estava cheia de trepadeiras. A esquerda ficava a primeira casa. Thorne via o telhado escuro. A direita da quadra de tênis, perto da loja, ele viu uma abertura
na folhagem espessa...
Uma trilha.
Thorne começou a andar, afastando-se da loja. Quando chegou perto da abertura nos arbustos, viu uma linha vertical. Era uma porta de madeira aberta. Havia
um galpão atrás da folhagem. A outra porta estava fechada. Thorne chegou mais perto e viu a placa de metal com letras vermelhas que pareciam negras ao luar.

AVISO
NON FUMARE
INFLAMÁVEL

Ele parou e escutou. Ouvia os rosnados dos raptores mas pareciam muito distantes, no alto da colina. Por algum motivo, eles não tinham se aproximado da vila
de casas.
Thorne esperou com o coração batendo forte, parado na entrada do galpão. Finalmente resolveu que as coisas não iam melhorar de nenhum modo. Eles precisavam
de gasolina.
O caminho que levava ao galpão estava ainda molhado de chuva, mas lá dentro estava tudo seco. Era um espaço pequeno, talvez 3 X 3. À luz fraca ele viu uma
dúzia mais ou menos de tambores enferrujados, de pé. Uns três ou quatro mais virados de lado. Thorne tocou em todos rapidamente. Todos leves, vazios.
Desanimado, Thorne voltou para a entrada do galpão. Parou por um momento, olhando para a claridade da lua lá fora. E então, ouviu o som inconfundível de respiração.

Na loja, Levine ia de janela em janela, tentando seguir os movimentos de Thorne. Ele estava inquieto e tenso. O que Thorne estava fazendo? Tinha se afastado
tanto da loja! Não era prudente. Levine olhava para a porta da frente, morrendo de vontade de trancá-la. Sentia-se tão indefeso sem a tranca na porta!
Agora Thorne tinha entrado numa moita de arbustos e ele não conseguia vê-lo. Já estava lá há muito tempo. Pelo menos um ou dois minutos.
Levine olhou pela janela e mordeu o lábio. Ouvi os rosnados distantes dos raptores. Eles tinham parado na entrada do caminho que levava ao laboratório. Não
tinham seguido os veículos até agora. Por que não? Era uma pergunta muito bem-vinda. Tranqüilizadora, quase animadora. Uma pergunta para ser respondida. Por que
os raptores tinham parado na entrada do laboratório?
Pensou em diversas explicações possíveis. Os raptores tinham um medo atávico do laboratório, o lugar em que tinham nascido. Lembravam das jaulas e não queriam
ser capturados outra vez. Mas Levine suspeitava que a explicação mais plausível era também a mais simples - a área em volta do laboratório era território de algum
outro animal, marcada com o cheiro e defendida e os raptores relutavam em entrar nela. Nem os tiranossauros, ele lembrou, tinham entrado naquele território sem parar
e hesitar primeiro.
Mas território de quem?
Levine esperava e olhava pela janela, impaciente.
- E as luzes? - Sarah disse da outra extremidade da loja. - Preciso de luz aqui.
- Num minuto - Levine disse.

Thorne parou na entrada do galpão, em silêncio, escutando.
Ouvia uma respiração entrecortada como a de um cavalo. Um animal grande, esperando. O som vinha da sua direita. Thorne olhou, virando o corpo lentamente.
Não viu nada. O luar iluminava todo o conjunto de casas. Ele via a loja, as bombas de gasolina, a sombra escura do jipe. Olhou para a direita e viu espaço
aberto, com moitas de rododendros e a quadra de tênis mais adiante.
Nada mais.
Olhou para a noite, procurando ouvir.
A respiração continuava. Pouco mais alta do que uma brisa leve. Mas não havia nenhuma brisa, as árvores e os arbustos estavam imóveis.
Ou não estariam?
Thorne tinha a impressão de que havia algo errado. Alguma coisa, bem na frente dos seus olhos, algo que ele poderia ver mas não via. Pensou que talvez devido
ao esforço para enxergar no escuro, seus olhos o estivessem enganando. Pensou notar um leve movimento nos arbustos à direita. O desenho das folhas parecia mudar
de padrão à luz da lua. Mudar e parar outra vez.
Mas ele não tinha certeza.
Thorne olhou atentamente para a frente e começou a pensar que o movimento não era nos arbustos mas na cerca de metal. A cerca era quase toda coberta por trepadeiras,
mas em alguns lugares o desenho de losangos de metal era visível. E havia algo estranho naquele desenho. A cerca parecia estar se movendo, se partindo.
Thorne olhou com atenção. Talvez esteja se movendo, pensou. Talvez haja uma animal dentro da cerca, empurrando, movendo o metal. Mas não parecia.
Era outra coisa qualquer...
De repente as luzes se acenderam na loja. Passaram pelas janelas com grades, traçando desenhos geométricos nas sombras em volta do espaço aberto e nos arbustos
ao lado da quadra de tênis. E por um momento - só por um momento - Thorne viu que os arbustos ao lado da quadra de tênis tinham uma forma estranha, e que eram na
verdade dois dinossauros com mais de dois metros de altura, lado a lado, olhando diretamente para ele.
Os corpos dos animais pareciam cobertos por uma colcha de retalhos de luz e sombra que os fazia iguais às folhas atrás deles e até à cerca da quadra de tênis.
Thorne ficou confuso. O disfarce era perfeito - perfeito demais - até as luzes da loja acenderem, surpreendendo-os.
Thorne olhou, prendendo a respiração. Então compreendeu que o desenho de luz e sombra que parecia um conjunto de folhas ia até a altura do peito. Acima disso,
os animais tinham uma espécie de losangos cruzados, exatamente como o desenho da cerca.
E enquanto Thorne olhava, o desenho complexo desapareceu, os animais ficaram brancos como giz e começou a aparecer uma série de listras de sombras verticais
como as barras das janelas.
E na frente dos seus olhos os dois dinossauros desapareceram outra vez. Esforçando-se ao máximo, tudo que ele via agora eram os contornos vagos dos dois corpos.
Ele jamais os veria se não soubesse que estavam ali.
Eram camaleões. Mas com a maior capacidade de mimetismo que Thorne já vira em qualquer camaleão.
Lentamente ele recuou para a parte mais escura do galpão.
- Meu Deus - Levine exclamou, olhando pela janela.
- Desculpe - disse Sarah. - Mas eu precisava acender a luz. Arby precisa de ajuda. Não posso fazer nada no escuro.
Levine não respondeu. Olhava pela janela tentando definir o que acabara de ver e compreendeu então o que o havia intrigado no dia em que Diego foi morto.
Aquela breve sensação de que alguma coisa não estava certa. Agora ele sabia. Mas era algo além de qualquer coisa que se conhecia sobre os animais da Terra e...
- O que foi? - Sarah perguntou, aproximando-se da janela.
- E Thorne?
- Veja - disse Levine.
Ela olhou entre as barras de ferro.
- Nos arbustos? O quê? O que há... .
- Veja - ele repetiu.
Sarah olhou atentamente, depois balançou a cabeça.
- Não vejo nada.
- Comece na base dos arbustos - disse Levine. - E vá olhando para cima devagar... Olhe... e vai ver o contorno.
Sarah suspirou.
- Não vejo.
- Então, apague as luzes, que vai ver.
Sarah apagou as luzes e por um momento Levine viu perfeitamente os dois animais, os corpos claros com linhas verticais à luz da lua. Quase imediatamente o
desenho começou a desaparecer.
Sarah voltou para a janela e dessa vez viu os animais imediatamente. Como Levine sabia que ela ia ver.
- Nossa - ela disse. - São dois?
- Sim, lado a lado.
- E... o desenho está se apagando?
- Sim. Está desaparecendo.
Enquanto olhavam, as listras na pele dos animais foram substituídas pelo desenho das folhas dos rododendros atrás deles. Mais uma vez os dois dinossauros
ficaram invisíveis. Mas aquele desenho complexo sugeria que as camadas da sua epiderme tinham uma disposição semelhante aos dos cromatóforos dos invertebrados marinhos.
Os tons sutis, a rapidez da mudança sugeriam...
- O que eles são? - Sarah perguntou, curiosa.
- Camaleões com uma capacidade excepcional de mimetismo. Talvez não se possa chamá-los de camaleões, uma vez que tecnicamente os camaleões só têm capacidade
para...
- O que eles são? - Sarah repetiu, impaciente.
- Eu diria que são Carnotaurus sastrei. Tipos de uma espécie da Patagônia. Três metros de altura com cabeças características - note os focinhos de buldogue
e os dois chifres grandes acima dos olhos. Quase como asas...
- São carnívoros?
- Sim, claro, eles têm o...
- Onde está Thorne?
- Ele entrou naquela moita de arbustos à direita há algum tempo. Não o vi mais depois disso, mas...
- O que vamos fazer?
- Fazer? - disse Levine. - Não sei o que está dizendo.
- Temos de fazer alguma coisa - Sarah disse, quase soletrando, como se estivesse falando com uma criança. - Precisamos ajudar Thorne a voltar para cá.
- Não sei como - Levine disse. - Aqueles animais devem pesar duzentos e cinqüenta quilos cada um. E são dois. Eu disse a ele que não saísse. Mas agora...
Sarah franziu a testa. Olhando para fora, ela disse:
- Acenda a luz outra vez.
- Eu preferia...
- Acenda as luzes!
Levine levantou, irritado. Estava saboreando aquela descoberta notável, uma característica realmente inesperada dos dinossauros - embora, é claro, não sem
precedentes entre os vertebrados - e agora essa mulher mandona estava dando ordens a ele. Levine estava ofendido. Afinal, ela não era propriamente uma cientista.
Era uma naturalista. Um campo desprovido de teoria. Uma dessas pessoas que remexem excremento de animais e pensam que estão fazendo uma pesquisa original. Uma boa
vida ao ar livre, nada mais. Não era ciência de modo algum.
- Acenda! - Harding gritou, olhando pela janela. Levine obedeceu e deu alguns passos para a janela.
- Apague!
Ele voltou rapidamente e apagou a luz.
- Acenda!
Levine acendeu. Sarah se afastou da janela e atravessou a sala.
- Eles não gostaram disso - ela disse. - Ficaram perturbados.
- Bem, talvez haja um período de refração...
- Sim. Acho que é isso. Tome, abra isto.
Apanhou um punhado de lanternas da prateleira, entregou para ele e foi apanhar as pilhas na outra prateleira.
- Espero que ainda funcionem.
- O que vai fazer? - perguntou Levine.
- Nós - ela disse. - Nós vamos fazer.
No galpão escuro, Thorne ficou imóvel, olhando para a porta. Viu acender e apagar a luz da loja. Depois, ficou acesa por algum tempo. Mas de repente apagaram
outra vez. A área na frente do galpão só estava iluminada pela lua.
Ouviu o ruído leve de movimento e outra vez a respiração. Então viu os dois dinossauros andando eretos, com as caudas rígidas na horizontal, para manter o
equilíbrio. O desenho dos corpos parecia mudar a cada passo e era difícil acompanhar o movimento, mas estavam se movendo na direção do galpão.
Os animais chegaram à porta e finalmente Thorne podia vê-los com clareza, os corpos em silhueta contra a luz da lua. Pareciam pequenos tiranossauros, a não
ser pelas protuberâncias entre os olhos e pelas patas dianteiras bem menores. Os carnívoros abaixaram a cabeça e olharam cautelosamente para dentro do galpão. Bufando,
farejando, balançando as caudas.
Eram grandes demais para passar pela porta e por um momento Thorne teve a esperança de que não fossem entrar. O que estava na frente abaixou a cabeça, rosnou
e deu um passo para dentro.
Thorne conteve a respiração, tentando em vão pensar em alguma coisa. Os animais eram metódicos, e o primeiro se afastou para o lado, dando espaço para o outro.
De repente, do lado da loja uma meia dúzia de luzes ofuscantes acenderam ao mesmo tempo. A luz se moveu e iluminou os corpos dos dois dinossauros. Depois
começou a se mover para a frente e para trás, formando desenhos desiguais, como holofotes à procura de alguma coisa.
Os dinossauros estavam claramente visíveis e não gostaram disso. Rosnaram e tentaram fugir do alcance da luz mas ela os perseguia, os fachos luminosos entrecruzando-se
nos seus corpos. A pele dos animais reproduzia os movimentos dos fachos de luz logo depois da passagem dos mesmos. Os corpos ficavam listrados de branco, as listras
escureciam, voltavam ao branco luminoso.
As luzes não paravam de se mover, a não ser quando incidiam nos focinhos dos dinossauros. Os olhos enormes piscavam sob as protuberâncias em forma de asas.
Eles abaixavam e balançavam a cabeça como para se livrar de um enxame de moscas.
Os dinossauros ficaram agitados. Recuaram e saíram do galpão, rugindo furiosos para as luzes.
As luzes continuavam a se mover, incansáveis, de um lado para o outro dentro da noite. O padrão de movimento era complexo, confuso. Os dinossauros rugiram
outra vez e deram um passo ameaçador na direção das luzes. Mas estavam indecisos. Sem dúvida não gostavam da idéia de chegar mais perto delas. Depois de um momento,
eles se afastaram, perseguidos pelos fachos de luz até além da quadra de tênis.
Thorne caminhou para a porta e ouviu a voz de Sarah.
- Doe? Acho melhor sair daí antes que eles voltem.
Thorne caminhou rapidamente na direção das luzes até onde Sarah e Levine balançavam dezenas de lanternas de um lado para o outro.
Os três voltaram para a loja.
Levine bateu a porta e encostou nela parecendo prestes a desmaiar.
- Nunca senti tanto medo em toda a minha vida - ele disse.
- Richard - Harding disse secamente. - Procure se controlar. - Ela atravessou a sala e pôs as lanternas em cima de um balcão.
- Foi loucura ir lá fora - Levine disse, enxugando a testa. Sua camisa estava molhada de suor.
- Na verdade foi um salto no escuro mas que deu certo - Sarah disse para Thorne. - Estava claro que é necessário um período de refração para a resposta da
pele à luz. É rápido se comparado, digamos, a um polvo, mas existe. Minha idéia foi que esses dinossauros são como todos os animais que dependem da camuflagem. São
basicamente animais de tocaia. Não especialmente rápidos ou ativos. Ficam imóveis durante horas num meio ambiente que não muda, desaparecendo, confundindo-se com
a paisagem de fundo, esperando que a caça apareça. Mas se tiverem de se ajustar a novas condições de luminosidade, sabem que não podem se esconder. Ficam ansiosos.
E se ficarem bastante ansiosos, acabarão fugindo. Exatamente o que aconteceu.
Levine olhou furioso para Thorne.
- A culpa foi sua. Se não ficasse andando lá fora...
- Richard - Sarah disse, interrompendo. - Precisamos de gasolina para sair daqui. Você não quer sair daqui?
Levine ficou calado, emburrado.
- Muito bem - disse Thorne. - O caso é que não encontrei nenhuma gasolina no galpão.
- Ei, pessoal - Sarah disse. - Vejam quem está aqui!

Arby se aproximou, amparado por Kelly. Estava com as roupas encontradas na loja, um calção de banho e uma camiseta que dizia "Laboratórios de Bioengenharia
InGen" e, mais abaixo, "Nós Fazemos o Futuro".
Arby tinha um olho roxo, um lado do rosto inchado e na testa o corte tratado por Sarah. Os braços e as pernas estavam cheios de equimoses, mas estava andando
e conseguiu sorrir.
- Como está se sentindo, filho? - Thorne perguntou.
- Sabe o que eu mais desejo neste momento?
- O quê? - perguntou Thorne.
- Uma Diet Coke. E uma porção de aspirina.

Sarah se inclinou ao lado de Malcolm, que cantarolava baixinho, olhando para o teto.
- Como está Arby? - ele perguntou.
- Vai ficar bom.
- Ele precisa de morfina?
- Não. Acho que não.
- Ótimo. - Malcolm estendeu o braço e arregaçou a manga.

Thorne tirou o ninho de dentro do microondas e esquentou um cozido de lata. Encontrou pratos de papelão decorados com motivo do Dia das Bruxas - abóboras
e morcegos - e serviu a comida. Os dois meninos comeram avidamente.
Thorne deu um prato para Sarah e voltou-se para Levine.
- E você?
Levine estava olhando pela janela.

-Não.
Thorne deu de ombros.
Arby estendeu o prato vazio.
- Tem mais?
- Claro - disse Thorne, dando seu prato para ele.

Levine sentou ao lado de Malcolm e disse.
- Bem, pelo menos estávamos certos sobre uma coisa. Esta ilha era um verdadeiro mundo perdido - uma ecologia pura, intocada. Estávamos certos desde o começo.
Malcolm tirou os olhos do teto e levantou cabeça.
- Está brincando? E todos aqueles apatossauros mortos?
- Estive pensando nisso - disse Levine. - Foram mortos pelos raptores, sem dúvida. E depois os raptores...
- Fizeram o quê? Arrastaram os animais mortos para seu ninho? Aqueles dinossauros pesam cinqüenta toneladas, Richard. Nem cem raptores poderiam arrastá-los.
Não, não. - Ele suspirou. - As carcaças devem ter flutuado para uma curva do rio e foram levadas para a margem. Os raptores fizeram seus ninhos numa fonte conveniente
de suprimento - apatossauros mortos.
- Bem, é possível...
- Mas por que tantos apatossauros mortos, Richard? Por que nenhum animal chega ao tamanho adulto? E por que há tantos predadores na ilha?
- Bem, é claro que precisamos de mais dados - começou Levine.
- Não, não precisamos. Você não examinou aquele laboratório? Já sabemos a resposta.
- E qual é? - Levine perguntou irritado.
- Príons - Malcolm disse, fechando os olhos.
- O que são príons? - Levine perguntou, intrigado. Malcolm suspirou.
- Ian, o que são príons?
- Vá embora - Malcolm disse, sacudindo a mão no ar.
Arby estava enrodilhado num canto, quase dormindo. Thorne enrolou uma camiseta e pôs debaixo da cabeça dele. Arby resmungou e sorriu.
Logo começou a roncar.
Thorne foi para perto de Sarah, na janela. Lá fora, o céu azul-claro começava a clarear.
- Quanto tempo agora? - ela perguntou.
Thorne consultou o relógio.
- Talvez uma hora.
Sarah começou a andar de um lado para o outro.
- Precisamos arranjar gasolina. Com gasolina, podemos'ir com o jipe até o local de pouso do helicóptero.
- Mas não temos.
- Tem de haver, em algum lugar. - Ela continuou a andar. - Você experimentou as bombas...
- Sim, estão secas.
- E no laboratório?
- Não acredito que tenha.
- Onde mais? E o trailer? Thorne balançou a cabeça.
- É só um veículo passivo, para ser rebocado. A outra unidade tem um gerador auxiliar e alguns tanques de gasolina. Mas despencou do penhasco.
- Talvez os tanques não tenham sido avariados com a queda. Temos ainda a moto. Talvez eu possa chegar até lá e...
- Sarah - ele disse.
- Vale a pena tentar.
- Sarah...
Da janela, Levine disse em voz baixa:
- Atenção! Temos visitas.

A BOA MÃE


Com o nascer do dia, os dinossauros saíram do meio das moitas e caminharam diretamente para o jipe. Eram seis, enormes bicos-de-pato marrons, quatro metros
e meio de altura, focinhos curvos para baixo.
- Maiassauros - Levine disse. - Eu não sabia que eles estavam ali.
- O que estão fazendo?
Os animais enormes se amontoaram em volta do jipe e imediatamente começaram a destruí-lo. Um rasgou a capota de lona. Outro balançava o veículo para a frente
e para trás.
- Eu não compreendo - Levine disse. - São hadrossauros herbívoros. Essa agressividade não é característica.
- Hum-hum - disse Thorne.
Os maiassauros viraram o jipe de lado. Um dos adultos recuou, subiu no painel lateral, começou a amassá-lo com os pés enormes.
Mas quando o jipe caiu, duas caixas de isopor branco rolaram no chão. Os maiassauros voltaram a atenção para as caixas. Começaram a morder o isopor, espalhando
pedaços por todo lado. Os animais se moviam apressadamente, quase frenéticos.
- Alguma coisa para comer? - sugeriu Levine. - Uma espécie de comida de dinossauro? O quê?
Então a tampa de uma caixa se partiu, e eles viram um ovo quebrado dentro. Saindo do ovo, viram o que parecia um pedaço de carne enrugada. Os maiassauros
ficaram mais calmos. Seus movimentos eram agora cautelosos, delicados. Grasnavam e rosnavam. Os corpos enormes dos animais não permitiam que vissem o que estavam
fazendo.
Ouviram um grito agudo.
- Está brincando - Levine disse.
Um animal minúsculo movia-se no chão. Era marrom-claro, quase branco. Tentou ficar de pé, mas caiu imediatamente. Não tinha mais de trinta centímetros, e
a pele formava dobras em volta do pescoço. Logo depois, outro animal caiu no chão ao lado dele.
Harding suspirou.
Lentamente um dos maiassauros abaixou a cabeça e com delicadeza apanhou o filhote com o bico largo. Sem fechar a boca, levantou a cabeça. O filhote ficou
sentado calmamente na língua do adulto, olhando em volta com a cabecinha erguida.
O segundo filhote foi também apanhado do chão. Os adultos agruparam-se em volta deles por um momento, como para decidir se precisavam fazer mais alguma coisa
e depois, grasnando alto, foram embora.
Deixaram o jipe virado e completamente amassado.
- Acho que a gasolina já não é um problema - Thorne disse.
- Acho que não - concordou Sarah.

Thorne olhou para os destroços do jipe, balançando a cabeça.
- Pior do que uma batida de frente. Parece que passou pelo compactador de metais. Não foi construído para esse tipo de pressão.
Levine bufou com desprezo.
- Os engenheiros em Detroit não esperavam que um animal de cinco toneladas ficasse em cima dele.
- Eu gostaria de ver como o nosso carro ia ficar se recebesse o mesmo tratamento.
- Está dizendo isso por causa do reforço que fizemos?
- Sim. Nós o construímos para agüentar uma pressão fantástica . Pressões enormes. Pesquisamos com programas de computador, acrescentamos painéis de carbono,
todo o...
- Espere um pouco - Sarah disse, afastando-se da janela. - De que você está falando?
- Do outro carro - disse Thorne.
- Que outro carro?

- O carro que trouxemos. O Explorer.
- Mas, é claro - ela disse, animada. - Temos outro carro! Eu tinha esquecido! O Explorer!
- Bem, ele agora é passado - eíxplicou Thorne - Entrou em curto a noite passada quando eu estava voltando para o trailer. Passei por uma poça d'água e o motor
sofreu um curto.
- E daí? Talvez ainda...
- Não. - Thorne balançou a cabeça. - Um curto desses queima o VR. É um carro elétrico. Está morto.
- Me admira que você não tenha fusíveis automáticos num carro desses.
- Bem, não costumamos instalar fusíveis, embora a última versão do carro... - Não terminou a frase e balançou a cabeça. - Eu não acredito.
- O carro tem fusíveis automáticos?
- Tem. Eddie instalou na última hora.
- Então, o carro pode ainda funcionar?
- Sim, provavelmente, se religarmos os fusíveis.
- Onde ele está? - Sarah perguntou, já andando para a moto.
- Deixei naquela estrada que sai da estrada do penhasco e desce na direção do abrigo. Mas, Sarah...
- E a nossa única chance. - Sarah prendeu o fone do rádio na cabeça, ajustou o microfone junto aos lábios e levou a moto para a porta. - Fale comigo pelo
rádio - ela disse. - Vou arranjar um carro para nós.
Eles ficaram olhando pela janela. Na luz do começo do dia, Sarah subiu na moto e seguiu para a encosta.
- Quais são as chances dela? - Levine perguntou. Thorne apenas balançou a cabeça.

Sarah disse no rádio:
- Thorne.
- Sim, Sarah.
- Estou subindo a colina agora. Estou vendo... são seis.
- Raptores?
- Sim. Eles estão, hã... Escute. Vou tentar outro caminho. Estou vendo uma...
O rádio crepitou.
- Sarah?
A voz dela estava desaparecendo..
- ...uma espécie de trilha de animais ,que... aqui ...eu acho melhor...
- Sarah. Sua voz está sumindo.
- ... fazer agora. Portanto ...seje-me sorte.
Ouviram o motor da moto, depois outro som, que podia ser o rosnado de um animal ou mais estática. Thorne inclinou para a frente, com o rádio no ouvido. Então,
de repente, ouviram um estalo e o rádio silenciou. Ele disse:
- Sarah? Nenhuma resposta.
- Deve ter desligado o rádio - disse Levine.
Thorne balançou a cabeça.
- Sarah?
Nada.
- Sarah? Está me ouvindo?
Esperaram.
Nada.
- Diabo - disse Thorne.

O tempo passou lentamente. Levine estava na janela, olhando para fora. Kelly roncava num canto. Arby estava deitado ao lado de Malcolm, profundamente adormecido.
E Malcolm cantarolava desafinado.
Thorne sentou no chão no centro da sala, encostado no balcão da registradora. Uma vez ou outra ele apanhava o rádio e tentava chamar Sarah, mas sem resposta.
Ele tentou seis canais. Não obteve resposta em nenhum deles.
Finalmente parou de tentar.

O rádio estalou.
- ... testo estas malditas coisas. Nunca funcionam direito. - Um resmungo de esforço. - Não consigo descobrir o que... as coisas... droga.
Levine na outra extremidade da loja desencostou da parede. Thorne apanhou o rádio.
- Sarah! Sarah!
- Até que enfim - ela disse, no meio da estática. - Onde diabo você esteve, Thorne?
- Você está bem?
- E claro que estou.
- Tem alguma coisa errada com o seu rádio. A transmissão está se interrompendo.
- E mesmo? O que devo fazer?
- Tente apertar a capa da bateria. Provavelmente está solta.
- Não. Quero saber o que devo fazer com o carro.
- O quê? - disse Thorne.
- Estou no carro, Thorne. Estou aqui. O que devo fazer? Levine olhou para o relógio.
- Faltam vinte minutos para o helicóptero chegar - ele disse. - Quer saber, ela é capaz de conseguir.

DODGSON


Dodgson acordou com o corpo todo dolorido no chão de cimento do galpão de depósito. Levantou e olhou pela janela. Viu listras vermelhas no céu azul-claro.
Abriu a porta e saiu.
Sentia muita sede e muita dor no corpo. Começou a andar sob as árvores copadas. A selva estava silenciosa no começo da manhã. Precisava de água. Mais do que
qualquer coisa, precisava de água. Ouviu vir da esquerda o som de água corrente. Seguiu na direção do som, andando mais depressa.
Através da folhagem ele via o céu cada vez mais claro. Sabia que Malcolm e seu grupo ainda estavam na ilha. Deviam ter um plano para sair dali. Se eles podiam
sair, ele também podia.
Chegou a uma pequena elevação e olhou para baixo, para a ravina e para o rio. Tudo parecia deserto. Dodgson desceu correndo a encosta, imaginando se a água
estaria poluída. Resolveu que não se importava. Estava quase chegando quando tropeçou e caiu praguejando.
Levantou e olhou para trás. Viu então no que tinha tropeçado.
Era a tira de uma mochila verde.
Dodgson puxou a tira e a mochila saiu do meio da folhagem. A mochila estava rasgada e coberta de sangue seco. Quando a puxou para fora, tudo o que havia dentro
caiu entre as samambaias. Moscas zumbiam por toda a parte. Mas ele viu uma câmera, uma caixa de metal para alimentos e uma garrafa de plástico com água. Procurou
rapidamente entre as samambaias. Mas não encontrou muita coisa mais, a não ser algumas barras de chocolate molhadas.
Dodgson tomou a água e então percebeu que estava com fome. Abriu a caixa de metal, esperando encontrar algo decente para comer. Mas a caixa não continha comida.
Estava cheia de isopor.
E no centro estava um rádio.
Dodgson ligou. A luz da bateria acendeu. Ele passou de um canal para o outro, ouvindo só estática.
Então uma voz de homem disse:
- Sarah? Aqui é Thorne. Sarah? Logo depois, uma voz de mulher:
- Thorne? Está me ouvindo? Eu disse que estou no carro. Dodgson ouviu e sorriu.
Então eles têm um carro.

Na loja, Thorne segurou o rádio perto do rosto.
- Tudo bem - ele disse. - Sarah, ouça com atenção. Entre no carro e faça exatamente o que vou dizer.
- Tudo bem. Mas antes me diga: Levine está aí?
- Ele está aqui.
O rádio estalou e depois ela disse.
- Pergunte se um dinossauro verde com mais ou menos um metro e vinte de altura e cabeça redonda é perigoso.
Levine fez que sim com a cabeça.
- Diga a ela que é. São chamados paquicefalossauros.
- Ele disse que é - Thorne transmitiu. - São paquicefalo-qualquer coisa e você deve ter cuidado. Por quê?
- Porque há uns cinqüenta deles em volta do carro.

O EXPLORER


O Explorer estava no meio da parte sombreada da estrada, sob árvores de galhos baixos. Tinha parado logo adiante de uma depressão que sem dúvida na noite
anterior era uma poça d'água. Agora era um buraco cheio de lama, graças a dezenas de animais que sentavam dentro dele, espirravam água, bebiam e rolavam em volta.
Eram os dinossauros verdes de cabeça redonda que ela estava observando há cinco minutos, tentando decidir o que podia fazer. Porque eles não estavam só perto da
poça, mas também em volta do carro.
Sarah observava os paquicefalossauros com certa inquietação. Ela havia passado muito tempo no campo com animais, mas geralmente com animais que conhecia bem.
Com sua longa experiência, sabia quanto podia se aproximar deles e em quais circunstâncias. Se aquilo fosse uma manada de gnus, ela entraria no meio deles sem hesitação.
Se fosse uma manada de búfalos americanos, teria cuidado, mas mesmo assim entraria. E se fosse uma manada de búfalos africanos, nem chegaria perto.
Pôs o microfone bem perto do rosto e disse.
- Quanto tempo ainda temos?
- Vinte minutos.
- Então acho melhor eu ir em frente - ela disse. - Alguma idéia?
Uma pausa. O rádio estalou.
- Levine diz que ninguém sabe coisa alguma sobre esses animais, Sarah.
- Que ótimo - ela disse. - ;
Sarah estudava a situação do carro e as árvores. Era uma área sombreada, calma e silenciosa à luz do começo do dia. Thorne disse no rádio:
- Levine diz que você pode tentar entrar bem devagar no meio deles para ver o que eles fazem. Mas nada de movimentos bruscos, nenhum gesto agressivo.
Ela olhou para o animais e pensou: eles têm aquelas cabeças redondas por alguma razão.
- Não, obrigada - ela disse. - Vou tentar outra coisa.
- O quê?

Na loja, Levine disse:
- O que ela disse?
- Disse que vai tentar outra coisa.
- O quê, por exemplo? - Levine foi até a janela. O céu estava cada vez mais claro. Ele franziu a testa. Havia alguma conseqüência proveniente desse fato,
pensou. Alguma coisa que estava no fundo de sua mente mas ele não conseguia lembrar.
Alguma coisa sobre a luz do dia...
E território.
Território.
Levine olhou outra vez para o céu, tentando lembrar. Que diferença fazia o fato de o sol estar nascendo? Balançou a cabeça e desistiu.
- Quanto tempo para religar os disjuntores?
- Um ou dois minutos - disse Thorne.
- Então, talvez ainda dê tempo.
Ouviram a estática no rádio e depois a voz de Sarah.
- Tudo bem. Estou acima do carro.
- Está onde?
- Acima do carro. Numa árvore.

Harding avançou para a frente, distanciando-se do tronco, sentindo o galho curvar sob seu peso. Mas parecia forte. Estava agora um metro acima do carro, balançando.
Poucos animais olharam para cima, mas o bando parecia inquieto. Os que estavam sentados na lama ficaram de pé e começaram a virar a cabeça e bater com os pés no
chão. As caudas balançavam nervosamente.
Sarah chegou mais para baixo e o galho curvou mais. Estava escorregadio por causa da chuva da noite. Ela tentou calcular sua posição em relação ao carro.
Parecia muito boa, pensou.
De repente, um dos animais arremeteu com força contra o tronco da árvore em que ela estava. O impacto foi surpreendentemente violento. A árvore estremeceu
e o galho balançou para cima e para baixo. Sarah se agarrou com força para não cair.
Oh, droga, ela pensou.
Ela subiu, desceu outra vez e então suas mãos escorregaram nas folhas e na casca molhada do galho-e ela caiu. No último momento, viu que não ia cair em cima
do carro. Então, bateu com força no chão lamacento.
Bem ao lado dos animais.

Thorne disse no rádio:
- Sarah? Nenhuma resposta.
- O que ela está fazendo agora? - Levine estava andando nervoso, de um lado para o outro. - Eu gostaria de ver o que ela está fazendo.
No canto da loja, Kelly levantou esfregando os olhos.
- Por que não usam o vídeo? - Apontou para a caixa registradora. - Aquilo é um computador.
- É mesmo?
- É. Acho que sim.

Bocejando, Kelly sentou na cadeira na frente da caixa registradora. Parecia um terminal sem importância, o que significava que não tinha acesso a muita coisa,
mas valia a pena tentar. Ligou o computador. Não aconteceu nada. Ela ligou e desligou o botão várias vezes. Nada.
Balançou as pernas e bateu com o pé no cabo debaixo da mesa. Inclinou-se e viu que o terminal estava desligado. Ligou o cabo.
A tela acendeu e apareceu uma única palavra.

LOGIN:
Para ir adiante Kelly sabia que precisava de uma senha. Arby tinha uma senha. Olhou para ele. Arby dormia e ela não queria acordá-lo. Lembrou que Arby tinha
escrito a senha e guardado o papel no bolso. Talvez ainda estivesse na roupa que ele tinha tirado. Kelly encontrou a roupa cheia de lama e começou a procurar nos
bolsos. Encontrou a carteira de Arby, as chaves da casa dele e mais alguma coisa. Finalmente achou um pedaço de papel no bolso traseiro. Estava molhado e cheio de
lama, a tinta escorrida, mas ainda dava para ler.
VIG/&*849/
Kelly voltou para o computador. Digitou cuidadosamente e apertou a tecla ENTER. A tela ficou branca e outra tela apareceu. Kelly ficou surpresa. Era diferente
da tela que tinha visto no trailer.

Ela estava no sistema. Mas tudo parecia diferente. Talvez porque não fosse a rede de rádio, pensou. Devia ter entrado no sistema do laboratório. Tinha mais
gráficos porque o terminal era ligado ao computador principal. Talvez eles até trabalhassem com fibra óptica.
No outro lado da loja, Levine perguntou:
- Kelly? E então?
- Estou trabalhando - ela disse.
Ela começou a digitar cautelosamente. Filas de ícones apareceram rapidamente na tela, uma depois da outra.


Kelly sabia que estava vendo uma espécie de interface gráfica, mas não sabia o significado das imagens. Não havia nenhuma explicação na tela. As pessoas que
usavam o sistema provavelmente aprendiam o que queriam dizer aquelas imagens. Mas Kelly não sabia. Ela queria entrar no sistema de vídeo, mas nenhum dós desenhos
sugeria alguma coisa ligada ao vídeo. Moveu o cursor pelos desenhos, pensando no que podia fazer.
Resolveu arriscar ao acaso. Escolheu o ícone em forma de losango no canto inferior esquerdo e clicou.

- Nossa - ela disse, alarmada.
Levine olhou para ela.
- Alguma coisa errada?
- Não. Está tudo bem. - Clicou rapidamente o cabeçalho no alto e voltou para a tela anterior. Experimentou então um dos ícones triangulares.
A tela mudou outra vez.

É isso, ela pensou. Imediatamente começaram a aparecer as imagens reais na tela. Naquele pequeno monitor de caixa registradora, as imagens eram muito pequenas,
mas agora ela estava em território conhecido e começou a mover rapidamente o cursor, manipulando as imagens.
- O que estão procurando? - Kelly perguntou.
- O Explorer - disse Thorne.
Ela clicou outra vez. A imagem se ampliou.
- Achei - ela disse.
- Achou? - perguntou Levine, surpreso. Kelly olhou para ele e disse:
- Isso mesmo. Eu achei.
Os dois homens olharam para a tela por cima do ombro de Kelly. Estavam vendo o Explorer numa estrada sombreada pelas árvores. Viam os paquicefalossauros,
uma porção deles, em volta do carro. Os animais estavam batendo nos pneus e no pára-choque dianteiro.
Mas não viam Sarah em lugar nenhum.
- Onde ela está? - disse Thorne.

Sarah Harding estava debaixo do carro, deitada de bruços na lama. Quando caiu, ela se arrastou para lá - era o único lugar para se esconder - e agora olhava
para os pés dos animais em volta dela. Sarah disse:
- Thorne. Está me ouvindo? Thorne? - Mas o maldito rádio estava enguiçado outra vez. Os paquis batiam os pés no chão e bufavam, tentando alcançá-la debaixo
do carro.
Então ela lembrou que Thorne tinha dito alguma coisa sobre apertar a tampa da bateria. Estendeu a" mão para trás, encontrou a bateria e apertou a capa com
força.
Imediatamente começou a ouvir estática.
- Thorne - ela disse.
- Onde você está? - perguntou Thorne.
- Debaixo do carro.
- Por quê? Você já tentou?
- Tentei o quê?
- Ligar. Ligar o carro.
- Não - ela disse. - Eu não tentei ligar o carro. Eu caí.
- Muito bem, já que está aí embaixo, pode verificar os disjuntores - disse Thorne.
- Os disjuntores ficam debaixo do carro?
- Alguns deles. Olhe nas rodas da frente. Sarah virou o corpo deslizando na lama.
- Muito bem, estou olhando.
- Tem uma caixa bem debaixo do pára-choque dianteiro. Um pouco para a esquerda.
- Estou vendo.
- Pode abrir a caixa?
- Acho que sim. - Ela se arrastou para a frente e puxou o fecho. A tampa saiu. Sarah viu três interruptores pretos. - Estou vendo três interruptores e estão
todos para cima.
- Para cima?
- Na direção da frente do carro.
- Hum - disse Thorne. - Isso não faz sentido. Pode ler o que está escrito?
- Posso. Diz: '15 W e depois '02 R´
- Tudo bem. Isso explica tudo.
- Explica o quê?
- A caixa está de trás para diante. Abaixe todos os interruptores. Você está seca?
- Não. Estou encharcada, deitada na maldita lama.
- Muito bem, então use a manga da camisa ou qualquer coisa assim.
Harding se arrastou mais para a frente, aproximando-se do pára-choque. Os paquis mais próximos bufaram e bateram no pára-choque. Eles se inclinaram para a
frente, virando a cabeça, tentando ver Sarah.
- Eles têm um hálito horrível - ela disse.
- O que você disse?
- Esqueça. - Ela abaixou todos os interruptores, um depois do outro e o carro zumbiu. - Muito bem. Já fiz. O carro está fazendo um barulho.
- Isso é ótimo - disse Thorne.
- O que eu faço agora?
- Nada. É melhor esperar.
Sarah deitou outra vez na lama e olhou para os pés dos paquis que continuavam em movimento e batendo no chão em volta dela,
- Quanto tempo ainda? - ela perguntou.
- Uns dez minutos.
- Bom. Estou presa aqui embaixo, Thorne.
- Eu sei.
Sarah olhou para o animais. Estavam ainda em volta do carro. Ao que parecia, ficavam cada vez mais ativos e nervosos. Batiam os pés e bufavam impacientes.
Então, de repente, todos correram para a frente do carro e para a estrada. Sarah virou o corpo e os viu sumir adiante.
Silêncio.
- Thorne? - ela disse. -Sim.
- Por que eles foram embora?
- Fique debaixo do carro - Thorne disse.
- Thorne?

- Não fale. - Ele desligou o rádio.
Sarah esperou, sem saber o que estava acontecendo. Mas sentiu a tensão na voz de Thorne. Ouviu então um ruído leve de alguma coisa se movendo e viu dois pés
ao lado da porta do motorista do Explorer.
Dois pés com botas enlameadas.
Botas de homem.
Harding franziu a testa. Conhecia aquelas botas. Conhecia também a calça caqui, mesmo cheias de lama como estava.
Era Dodgson.

As botas viraram para a porta e Sarah ouviu a porta se abrir.
Dodgson estava entrando no carro.
Sarah agiu rapidamente, quase sem pensar. Com esforço virou o corpo para o lado, estendeu os braços, agarrou os dois tornozelos e puxou com força. Dodgson
caiu com um berro de surpresa. Caiu de costas e virou a cabeça, furioso.
Viu Sarah e disse, zangado:
- Que droga. Pensei que tivesse acabado com você no barco. Furiosa, Sarah começou a sair de baixo do carro. Dodgson
ficou de joelhos quando ela estava quase fora, e então a terra tremeu. Sarah sabia o que era. Dodgson olhou para trás, deitou de bruços e começou a se arrastar
para debaixo do carro.
Sarah virou o corpo na lama e olhou para a estrada. Viu um tiranossauro andando na direção deles. O solo vibrava a cada passo do animal. Dodgson estava se
arrastando para o centro do carro, chegando mais perto dela, mas Sarah o ignorou. Viu os pés enormes com garras chegarem perto do carro e parar. Cada pé tinha um
metro de comprimento. O tiranossauro rosnou.
Sarah olhou para Dodgson, para os olhos arregalados de terror. Os pés enormes se moveram e Sarah o ouviu bufar, farejando. Então, com outro rosnado, a cabeça
abaixou. A mandíbula inferior tocou o solo. Sarah não via o olho, só a mandíbula. O tiranossauro farejou outra vez, lenta e demoradamente.
Estava sentindo o cheiro deles.
Ao seu lado, Dodgson tremia incontrolavelmente. Mas Harding estava estranhamente calma. Sabia o que tinha de fazer. Com um movimento rápido, ela girou o corpo
e firmou os ombros contra a roda traseira do carro. Dodgson virou para olhar no momento em que ela começou a chutar as canelas dele. Empurrando as pernas de Dodgson
para fora.
Apavorado, Dodgson lutou para se defender, tentando empurrar as pernas dela, mas Sarah estava em posição vantajosa. Pouco a pouco, as botas dele saíram debaixo
do carro para a luz fria da manhã. Depois a perna. Sarah empurrava com força, concentrando toda a sua energia. Com voz esganiçada de medo, Dodgson disse:
- Que diabo está fazendo?
O tiranossauro rosnou. Sarah viu que os pés enormes estavam se movendo.
- Pare! - disse Dodgson. - Está louca? Pare com isso!
Mas Sarah não parou. Encostou o pé no ombro dele e empurrou. Por algum tempo Dodgson tentou resistir e então, de repente, o corpo dele pareceu ficar mais
leve e ela viu que o tiranossauro tinha abocanhado as duas pernas e estava puxando Dodgson para fora.
Dodgson segurou a bota de Sarah com as duas mãos, tentando arrastá-la com ele. Sarah deu um pontapé no rosto dele. Dodgson escorregou para fora.
Sarah viu o rosto dele, pálido, a boca aberta. Dodgson não disse uma palavra. Ela viu os dedos enterrarem-se na lama, deixando marcas profundas. Então, o
corpo foi arrastado para fora. Tudo estava estranhamente quieto. Ela viu Dodgson girar o corpo, ficar de costas na lama e olhar para cima. Viu a sombra do tiranossauro
cair sobre ele. Viu a cabeça enorme abaixar, a boca aberta. E ouviu Dodgson começar a gritar quando as mandíbulas se fecharam no seu corpo e o ergueram do chão.

Sem parar de gritar, Dodgson foi erguido a seis metros do solo. Sabia que a qualquer momento o dinossauro iria fechar a boca enorme e ele estaria morto. Mas
as mandíbulas não se fecharam. Dodgson sentiu uma dor aguda no lado do corpo, mas as mandíbulas continuavam abertas.
Sempre gritando, Dodgson foi carregado para a selva. Os galhos altos das árvores arranhavam seu rosto. O hálito do animal passava em ondas quentes sobre seu
corpo. Saliva pingava no seu peito. Ele pensou que fosse desmaiar de terror. Mas as mandíbulas não se fecharam.
Na loja, eles viram no monitor quando Dodgson foi carregado na boca aberta do tiranossauro. Pelo rádio ouviam seus gritos estridentes.
- Estão vendo? - Malcolm disse. - Deus existe. Levine estava intrigado. ~
- O rex não o matou. - Apontou para a tela. - Vejam, ele está mexendo os braços. Por que ele não o matou?
Sarah Harding esperou até já não ouvir os gritos. Saiu de baixo do carro e ficou de pé à luz da manhã. Abriu a porta e entrou no carro. Com os dedos sujos
de lama, girou a chave que estava na ignição. Uma pequena explosão, e depois o zumbido do motor. Todas as luzes do painel acenderam. Depois silêncio. Estava funcionando?
Sarah virou a direção e o carro se moveu com facilidade. Então, estava tudo em ordem.
- Thorne.
- Sim, Sarah.
- O carro está em ordem. Estou voltando.
- Tudo bem - ele disse. - Depressa.
Ela engatou a marcha e a transmissão funcionou. O carro era, estranhamente, quase silencioso. Por isso ela pôde ouvir o ruído distante do helicóptero.

A LUZ DO DIA


Sarah dirigia sob as copas fechadas das árvores, de volta para a vila. O som do helicóptero crescia de volume. Então ele passou sobre onde ela estava, encoberto
pela folhagem. Com os vidros abaixados, Sarah prestou atenção. O helicóptero parecia estar indo para o sul.
- Sarah - Thorne disse no rádio.
- Sim.
- Escute, não podemos nos comunicar com o helicóptero.
- Tudo bem. - Ela sabia o que devia ser feito. - Onde é o local de pouso?
- Ao sul, mais ou menos dois quilômetros. Numa clareira. Vá pela estrada do penhasco.
Ela estava chegando à bifurcação e viu a estrada do penhasco à direita.
- Tudo bem. Estou indo.
- Diga que espere por nós. Depois venha nos buscar.
- Estão todos bem? - ela perguntou.
- Todos estão ótimos - disse Thorne.
Ela seguiu pela estrada, ouvindo a mudança no som do helicóptero. Devia estar pousando. O rotor continuava a girar com um zumbido surdo, o que significava
que o piloto não iria desligar o motor.
A estrada fazia uma curva para a esquerda. O som do helicóptero era agora uma batida surda. Sarah acelerou na curva. A estrada estava molhada ainda da chuva
da noite anterior. O carro não levantava poeira nenhuma. Nada revelava a presença do carro na estrada.
- Thorne. Quanto tempo eles vão esperar?
- Eu não sei. Está vendo o helicóptero?
- Ainda não.

Na janela Levine olhava para o céu cada vez mais claro, entre as árvores. As listras vermelhas tinham desaparecido e agora tudo era azul. A luz do dia estava
chegando.
A luz do dia...
Então ele lembrou e estremeceu. Foi para a janela no outro lado da loja e olhou para a quadra de tênis, para o lugar em que os carnotauros tinham estado.
Já não estavam lá.
Exatamente o que ele temia.
- Isto não é bom - ele disse.
- São só oito horas - Thorne disse, consultando o relógio.
- Quanto tempo ela vai levar para chegar ao helicóptero?
- Não sei - respondeu Thorne. - Três ou quatro minutos.
- E para chegar aqui?
- Mais uns cinco minutos.
- Espero que estejamos a salvo até então - disse Levine, franzindo a testa, preocupado.
- Por quê? - disse Thorne - Estamos bem.
- Dentro de alguns minutos - Levine disse - o sol estará iluminando tudo lá fora.
- E daí? - Thorne disse.
- Thorne - Sarah disse no rádio. - Estou vendo o helicóptero.

Sarah fez a última curva e viu o helicóptero à sua esquerda, as hélices girando. Havia outra bifurcação e uma estrada estreita descia, atravessava a selva
e chegava na clareira. Sarah desceu por ela, diminuindo a marcha nas curvas fechadas. Estava outra vez no meio da selva, sob as copas das árvores. Chegou ao plano,
atravessou um regato estreito e acelerou.
Logo adiante o sol iluminava a clareira. Ela viu o helicóptero. Os rotores começavam a girar com maior velocidade - ia levantar vôo! Ela viu o piloto com
óculos escuros. Ele consultou o relógio, balançou a cabeça para o co-piloto e o helicóptero começou a se erguer do solo.

Sarah buzinou e acelerou loucamente. Mas sabia que eles não podiam ouvir. O carro saltava e derrapava. Thorne disse no rádio:
- O que está acontecendo? Sarah? O que está acontecendo? Ela seguiu em frente, com a cabeça para fora do carro gritando.
- Esperem! Esperem!
Mas o helicóptero já estava subindo, desaparecendo da sua vista. Quase não se ouvia o motor. Quando o carro saiu da selva para a clareira, o helicóptero ia
na direção na margem rochosa da ilha.
E desapareceu.
- Vamos ficar calmos - Levine disse, andando de um lado para o outro na pequena loja. - Diga a ela que volte imediatamente. E vamos ficar calmos. - Era como
se estivesse falando sozinho, enquanto andava para lá e para cá, batendo nas paredes de madeira com os punhos fechados. Balançou a cabeça, desanimado. - Diga a ela
que se apresse. Acha que ela pode estar aqui em cinco minutos?
- Sim - disse Thorne - Por quê? O que há, Richard? Levine apontou para as janelas.
- A luz do dia - ele disse. - Com a luz do dia estamos encurralados aqui.
- Estivemos presos aqui durante toda a noite - Thorne disse.
- E tudo correu bem.
- Mas a luz do dia é diferente.
- Por quê?
- Porque à noite isto é território dos carnotauros. Os outros animais não entram aqui. Não vimos nenhum outro animal a noite passada. Mas quando chega o dia,
os carnotauros já não podem se esconder. Não nos espaços abertos, iluminados pelo sol. Então eles vão embora. E isto deixa de ser seu território.
- E o que isso quer dizer?
Levine olhou para Kelly sentada na frente do computador. Hesitou e depois disse:
- Acredite em mim. Temos de sair daqui imediatamente.
- E ir para onde?

Na frente do computador, Kelly ouvia a conversa dos dois homens. Olhou para o papel onde Arby havia escrito a senha. Estava muito nervosa. O modo como o Dr.
Levine falava a deixava nervosa. Gostaria que Sarah já tivesse voltado. Sentia-se mais segura quando Sarah estava por perto.
Kelly não queria pensar na situação real. Tinha se controlado, procurado manter a calma até a chegada e a partida do helicóptero. Nenhum dos homens disse
quando ele ia voltar. Talvez eles soubessem de alguma coisa. Talvez soubessem que não ia voltar.
O doutor Levine estava dizendo que precisavam sair da loja. Thorne perguntou para onde ele queria ir. Levine disse:
- Eu gostaria de sair desta ilha. Mas não vejo como. Por isso, acho que devíamos voltar para o trailer. No momento é o lugar mais seguro.
De volta ao trailer, ela pensou. De onde ela e Sarah tinham tirado Malcolm. Kelly não queria voltar para o trailer.
Ela queria ir para casa.
Tensa, Kelly alisou o papel com a senha que estava na mesa, ao lado dela. O Dr. Levine foi até ela.
- Pare de brincar - ele disse. - Veja se consegue encontrar Sarah.
- Eu quero ir para casa - Kelly disse.
- Eu sei, Kelly. - Levine suspirou. - Nós todos queremos ir para casa. - Ele se afastou a passos rápidos e tensos.
Kelly apanhou o pedaço de papel, virou e pôs debaixo do teclado para o caso de precisar da senha outra vez. Então viu que havia alguma coisa escrita nas costas
do papel.
SÍTIO B - LEGENDAS
ALA LESTE ALA OESTE ÁREA DE CARGA
LABORATÓRIO ÁREA DE MONTAGEM ENTRADA
PLANO GERAL ÁREA CENTRAL GEOTURBINA
LOJA DE CONVENIÊNCIA VILA DOS TRABALHADORES GEOCENTRO
POSTO DE GASOLINA PISCINA/TÊNIS CAMPO DE GOLFE
CASA DO ADMINISTRADOR PISTA DE CORRIDA TUBULAÇÃO DE GÁS
SEGURANÇA UM SEGURANÇA DOIS CONDUTORES TÉRMICOS
DOCA FLUVIAL CASA DE BARCOS SOLAR UM
ESTRADA DO PÂNTANO ESTRADA DO RIO ESTRADA DA CORDILHEIRA
ESTRADA DAS MONTANHAS ESTRADA DO PENHASCO JAULAS

Kelly reconheceu imediatamente a cópia feita por Arby da tela do apartamento de Levine, quando estava recuperando os arquivos do computador. Parecia há milhões
de anos, em outra vida. Mas na realidade tinha sido... há quanto tempo? Dois dias.
Lembrou do orgulho de Arby quando recuperou os dados. Lembrou de que todos tinham procurado decifrar a lista. Agora, é claro, todas as indicações tinham sentido.
Eram lugares reais, o laboratório, a vila dos trabalhadores, a loja de conveniências, o posto de gasolina...
Kelly olhou para a lista.
Está brincando, ela pensou.
- Dr. Thorne - Kelly disse. - Acho melhor dar uma olhada nisto.

Thorne olhou para a lista.
- Você acha? - ele perguntou.
- E o que diz aqui. Casa de barcos.
- Pode encontrá-la, Kelly?
- Quer dizer, encontrar no vídeo? - Ela deu de ombros. - Posso tentar.
- Tente - Thorne disse e olhou para Levine, no outro lado da loja, dando socos nas paredes. Apanhou o rádio.
- Sarah? E Thorne.
- Thorne? Tive de parar por um minuto.
- Porquê?

Sarah Harding estava parada na estrada do penhasco. O tiranossauro estava seguindo na mesma direção, cinqüenta metros à frente dela, levando Dodgson na boca.
E Dodgson ainda estava vivo. O corpo ainda se mexia. Sarah teve a impressão de ouvir os gritos dele.
Ficou surpresa por não sentir nada por ele. Olhou impassível o tiranossauro sair da estrada e caminhar para uma descida, voltando para a selva.
Sarah ligou o motor e seguiu cautelosamente pela estrada.
Na frente do computador, Kelly passou de uma imagem para outra, até encontrar a doca de madeira, dentro do galpão dos barcos, aberto numa das extremidades.
O interior do galpão parecia em ordem com muitas trepadeiras e samambaias por cima de tudo. Viu um bote a motor balançando, batendo na doca. Viu três tambores de
óleo num lado. E na outra extremidade ela via água e a luz do sol. Parecia um rio.
- O que acha? - ela perguntou para Thorne.
- Acho que vale a pena tentar. Mas onde fica? Pode encontrar um mapa?
- Talvez - Kelly disse. Digitou no teclado e conseguiu voltar para a tela principal, com os ícones misteriosos.

Arby acordou, bocejou e foi ver o que ela estava fazendo.
- Belos gráficos - ele disse. - Você conseguiu entrar, hein? - È - disse Kelly. - Eu consegui. Mas estou tendo problema para decifrar.
Levine andava de um lado para o outro e olhava pelas janelas. - Isto tudo é muito bom - ele disse. - Mas está ficando cada vez mais claro lá fora. Vocês
não compreendem? Precisamos sair daqui. Esta é uma construção de paredes simples. É ótimo para os trópicos, mas basicamente é uma cabana.
- Vai servir - disse Thorne.
- Talvez por uns três minutos. Quero dizer, veja isto. - Levine foi até a porta e bateu com a mão fechada na madeira - Esta porta é só...
Com um estalo, a madeira quebrou em volta da fechadura e a porta se abriu. Levine foi atirado para o lado e caiu no chão. O raptor estava rosnando parado
na porta.

A SAÍDA


Sentada na frente do computador, Kelly gelou de terror. Viu Thorne correr para a frente, pondo todo o peso do corpo na porta, batendo-a contra o raptor. Tomado
de surpresa, o animal foi atirado para trás. A porta fechou na mão com garras afiadas. Thorne continuou encostado na porta. No outro lado, o animal rosnava e batia
na madeira.
- Me ajude! - Thorne gritou.
Levine correu e encostou na porta ao lado dele.
- Eu disse! - gritou Levine.
De repente, os raptores cercaram a loja. Rosnando, eles se atiravam contra as janelas, amassando as barras de aço, empurran-do-as na direção dos vidros. Batiam
nas paredes de madeira, derrubando estantes; as latas e garrafas despencavam no chão. Em vários lugares as paredes começaram a rachar.
Levine gritou para Kelly.
- Descubra uma saída daqui!
Kelly ficou parada. O computador estava esquecido.
- Vamos, Kel - disse Arby. - Concentre-se.
Ela olhou para a tela, sem saber o que fazer. Clicou na cruz do canto esquerdo. Não aconteceu nada. Clicou o círculo na extremidade superior esquerda. De
repente, ícones começaram a aparecer um depois do outro, enchendo a tela.

- Não se preocupe, deve haver uma tecla que explique tudo - Arby disse. - Só precisamos saber qual...
Mas Kelly não estava ouvindo, apertando teclas e movendo o cursor, tentando fazer acontecer alguma coisa, uma tela de ajuda, qualquer coisa.
De repente a tela toda começou a distorcer.
- O que você fez? - perguntou Arby, assustado.


Kelly estava suando.
- Não sei. - Tirou a mão do teclado.
- Ficou pior - disse Arby. - Você piorou tudo.
A tela continuava a se mover estranhamente, os ícones mudando, distorcendo lentamente.
- Vamos com isso, meninos! - Levine gritou.
- Estamos tentando! - disse Kelly.

Arby disse:
- Está se transformando num cubo.
Thorne empurrou para a porta a geladeira com frente de vidro que ocupava uma parede. O raptor batia contra o metal, sacudindo as latas que estavam dentro.
- Onde estão as armas? - perguntou Levine.
- Sarah tem três no carro.
- Ótimo. - Algumas barras das janelas estavam tão amassadas que tinham quebrado o vidro. Na parede da direita a madeira estava aberta em vários lugares.
- Temos de sair daqui - Levine gritou para Kelly. - Temos de encontrar uma saída! - Correu para o fundo da loja, para os banheiros. Mas logo voltou. - Eles
estão lá atrás também.
Estava acontecendo muito depressa em volta deles. Na tela, Kelly via agora um cubo que girava no espaço. Ela não sabia o que fazer.

- Vamos, Kel - disse Arby, com os olhos inchados atentos na tela. - Você pode. Concentre-se. Vamos.

Todos gritavam ao mesmo tempo. Kelly olhava para o cubo na tela, completamente perdida. Não sabia mais o que estava fazendo. Não sabia por que estava ali.
Não sabia o significado de coisa alguma. Ao lado dela, Arby disse:
- Vamos. Clique os ícones um por um, Kel. Você pode fazer isso. Vamos. Preste atenção. Focalize sua mente.
Mas ela não podia. Não podia clicar os ícones que giravam rapidamente na tela. Devia haver processadores paralelos para lidar com os gráficos. Ela apenas
olhava, pensando nas coisas mais variadas - pensamentos que chegavam sem controle à sua mente.
O cabo debaixo da mesa.
Ligado ao computador geral.
Uma porção de gráficos.
Sarah falando com ela no trailer.
- Vamos, Kel. Tem de fazer isso agora. Encontre uma saída. No trailer Sarah tinha dito: A maior parte do que as pessoas
dizem está errada.
- É importante, Kel - disse Arby, tremendo, ao lado dela. Kelly sabia que ele se concentrava em computadores como um
meio de bloquear certas coisas. Como um meio de...
A parede se abriu, um painel de oito polegadas caiu para dentro e o raptor enfiou a cabeça na abertura, rosnando, abrindo e fechando a boca.
Kelly continuou a pensar no cabo debaixo da mesa. O fio debaixo da mesa. Seus pés tinham batido no fio debaixo da mesa.
O cabo debaixo da mesa.
- E importante - repetiu Arby. E então ela descobriu.
- Não - ela disse. - Não é importante. - Saiu da cadeira e foi para debaixo da mesa.
- O que está fazendo? - Arby gritou.
Mas Kelly já tinha a resposta. Viu que o cabo do computador seguia pelo chão passando por um buraco redondo. Ela viu a emenda na parede. Kelly puxou o cabo
e de repente o painel se soltou em suas mãos. Ela olhou para baixo. Tudo escuro.
Sim.
Espaço para uma pessoa se arrastando. Nada mais. Um túnel.
Ela gritou.
- Por aqui!

A geladeira caiu para a frente. Os raptores partiram a porta da frente. Nos lados da loja, outros animais derrubavam as paredes, empurrando as estantes. Os
raptores saltaram para dentro, rosnando e dando marradas. Encontraram as roupas molhadas de Arby e as rasgaram, furiosos.
Eles se moviam rapidamente, como caçadores.
Mas as pessoas tinham desaparecido.

A FUGA


Kelly ia na frente com uma lanterna. Seguiam em fila indiana entre as paredes de concreto. Estavam dentro de um túnel de um metro quadrado, com suportes de
metal para cabos no lado esquerdo. Os canos de água e de gás ficavam perto do teto. O túnel cheirava a mofo. Kelly ouvia os guinchos dos ratos.
Chegaram a uma bifurcação. Ela olhou para os dois lados. A passagem da direita era longa e reta, e tudo parecia escuro. Provavelmente levava ao laboratório,
ela pensou. A da esquerda era muito mais curta, com alguns degraus no fim.
Kelly foi para a esquerda.
Subiu os degraus do poço estreito de concreto e empurrou a porta de madeira do alçapão, no alto. Chegou a uma sala pequena cheia de cabos e canos enferrujados.
A luz entrava pelas janelas quebradas. Os outros subiram atrás dela.
Kelly olhou pela janela e viu Sarah Harding no Explorer, descendo a colina na direção deles.
Sarah dirigia o Explorer, seguindo a margem do rio. Kelly estava ao lado dela no banco da frente. Viram a placa indicando a casa de barcos.
- Então, foram os gráficos que deram a pista, Kelly? - Sarah disse, admirada.
Kelly fez que sim com a cabeça.
- De repente eu compreendi que não importava o que estava vendo na tela. O importante era a quantidade de dados que estava sendo manipulada, milhões de sinais
girando, e isso significava que devia haver um cabo. E, se havia um cabo, tinha de haver espaço para ele. E espaço suficiente para consertar o cabo em caso de avaria
e tudo o mais.
- Então você procurou debaixo da mesa. -Sim.
- Isso foi muito bom - disse Harding. - Acho que essa gente toda deve a vida a você.
- Na verdade, não - disse Kelly com um leve erguer de ombros.
Sarah olhou para ela.
- Durante toda a sua vida, outras pessoas vão tentar roubar de você o que você conquistar. Não roube de você mesma.
A estrada ao longo do rio estava cheia de lama e de plantas. Ouviam os gritos distantes dos dinossauros, em algum lugar atrás deles. Harding fez a volta numa
árvore caída e então eles viram a casa de barcos.
- Oh, oh - disse Levine. - Tenho um mau pressentimento. Por fora, a casa de barcos estava em ruínas e coberta de
vegetação. O telhado estava caído em vários lugares. Ninguém mais disse nada. Sarah parou o Explorer na frente de uma porta dupla larga, fechada com um cadeado
enferrujado. Saltaram do carro e seguiram para a casa com lama até os tornozelos.
- Você acha mesmo que há um barco aí dentro? - Arby duvidou.
Malcolm se apoiou em Sarah e Thorne atacou a porta com todo o seu peso. A madeira apodrecida rachou, depois partiu. O cadeado caiu no chão. Sarah disse:
- Aqui, segure um pouco. - Passou o braço de Malcolm pelos ombros de Thorne. Então, com um pontapé, abriu um buraco na porta, suficiente para passar agachada
e entrou. Tudo estava escuro. Kelly entrou atrás dela.
- O que está vendo? - Levine perguntou, arrancando tábuas para aumentar a abertura. Uma aranha cabeluda subiu por uma tábua e saltou para longe.
- Há um barco aqui - Sarah disse. - E parece em ordem. Levine enfiou a cabeça na abertura.
- Caramba - ele disse. - Acho que vamos poder sair daqui, afinal.

A SAÍDA


Lewis Dodgson caiu.
Rolando no ar, caiu da boca do tiranossauro no chão de terra. Ficou sem ar, bateu a cabeça com força e ficou atordoado por um momento. Abriu os olhos e viu
uma parede baixa de lama seca. Sentiu o cheiro ácido de coisa deteriorada. E então ouviu um som que o deixou gelado. Um guincho estridente.
Levantou o corpo apoiado no cotovelo e viu que estava dentro do ninho do tiranossauro. Dentro das paredes de terra, havia três filhotes no ninho, incluindo
um com uma tala de alumínio em volta da perna. Os filhotes gritavam excitados, andando para ele com passos ainda incertos.
Dodgson ficou de pé, sem saber o que fazer. O outro tiranossauro adulto estava na outra extremidade do ninho, ronronando e bufando. O que o havia levado até
ali estava de pé ao lado dele.
Dodgson viu os filhotes se aproximando dele com os anéis de penugem nos pescoços e os dentes afiados. Então, ele se virou para correr. Num instante o adulto
abaixou a cabeça e o derrubou. Então o tiranossauro levantou a cabeça outra vez e esperou. Olhando.
Que diabo está acontecendo?, pensou Dodgson. Cautelosamente, levantou outra vez. E outra vez foi derrubado. Os filhotes gritaram e continuaram a se aproximar.
Dodgson viu que os corpos deles estavam cobertos de carne podre e excremento. O cheiro era horrível. Dodgson ficou de quatro e começou a engatinhar para longe deles.
Alguma coisa segurou sua perna. Ele olhou para trás e viu que seu pé estava na boca do tiranossauro. O animal enorme segurou a perna delicadamente por um
momento entre os dentes. Então mordeu. Os ossos estalaram e amassaram.
Dodgson gritou de dor. Já não podia se mexer. Não podia fazer nada além de gritar. Os filhotes avançaram avidamente. Por alguns segundos ficaram a certa distância,
avançando a cabeça para a frente para pequenas mordidas. Mas então, vendo que Dodgson não se movia, um saltou sobre a perna e começou a morder a carne ensangüentada.
O segundo saltou para a virilha e começou a morder na altura da cintura.
O terceiro chegou perto da cabeça e abocanhou o rosto com uma mordida. Dodgson urrou. Viu o filhote comendo a carne do seu rosto, com o sangue pingando das
mandíbulas. O filhote inclinou a cabeça para trás e engoliu a parte do rosto de Dodgson. Então voltou, abriu a boca e a fechou em volta do pescoço.

SÉTIMA CONFIGURAÇÃO


Pode ocorrer uma reestabilização parcial após a eliminação dos
elementos destrutivos. A sobrevivência é em parte determinada
por eventos fortuitos.


IAN MALCOLM

A PARTIDA


O barco deixou o rio no meio da selva e entrou na caverna escura. O ruído do motor ecoava nas paredes. Thorne pilotava seguindo a rápida corrente que os levava
para fora da caverna. À esquerda, uma cachoeira descia na rocha, iluminada por um raio de sol. Então saíram da caverna afastando-se dos rochedos íngremes da costa
e das ondas que batiam nas pedras, a caminho do mar aberto. Kelly deu um grito de alegria e abraçou Arby, que fez uma careta e sorriu. Levine olhou para a ilha.
- Tenho de admitir que nunca pensei que fôssemos conseguir. Mas com as nossas câmeras nos lugares certos, e com a rede funcionando, acho que podemos continuar
a colher dados, até termos a resposta para a causa da extinção.
Sarah Harding olhou para ele.
- Talvez sim, talvez não.
- Por que não? É um perfeito Mundo Perdido.
Sarah olhou para ele incrédula.
- Não é nada disso. Predadores demais, está lembrado?
- Bem, pode parecer que sim, mas não sabemos.
- Richard - ela disse. - Ian e eu verificamos os registros. Eles cometeram um erro nesta ilha há muitos anos. Quando o laboratório estava ainda produzindo.
- Qual erro?
- Estavam fabricando filhotes de dinossauros e não sabiam como alimentá-los. Durante um tempo, davam leite de cabra, o que era bom. E muito hipoalergênico.
Mas quando os carnívoros cresciam, eles davam um extrato especial de proteína. E esse extrato era feito de ovelhas criadas em cativeiro.
- E daí? O que há de errado nisso?
- Num zoológico, nunca se usa extrato de ovelha - ela disse. - Por causa do perigo de infecção.
- Infecção - Levine disse em voz baixa. - Que tipo de infecção?
- Príons - Malcolm disse, do outro lado do barco. Levine não entendeu.
- Príons - disse Sarah - são as entidades mais simples causadoras de doenças, mais simples do que os vírus. São fragmentos de proteína. Tão simples que não
podem invadir o corpo - têm de ser ingeridas passivamente. Mas, uma vez ingeridas, provocam doenças, nas ovelhas, e uma doença do cérebro que ataca os seres humanos.
E os dinossauros desenvolveram uma doença chamada DX, causada por uma remessa infectada de extrato de ovelha. O laboratório lutou durante anos para debelar a doença.
- Está dizendo que não conseguiram?
- Durante algum tempo, parecia que tinham conseguido. Os dinossauros estavam se desenvolvendo muito bem. Mas então aconteceu alguma coisa e a doença começou
a se disseminar. Os príons são excretados com as fezes, portanto é possível...
- Excretados com as fezes? - disse Levine. - Os comps estavam comendo fezes...
- Sim, todos os comps estão infectados. Os comps são necrófagos, espalham a proteína pelas carcaças, infectando outros necrófagos. No fim, todos os raptores
estavam infectados. Os raptores atacam animais saudáveis, nem sempre com sucesso. Uma mordida, e o animal está infectado. Assim, mordida a mordida, a infecção se
disseminou outra vez na ilha. Por isso os animais morrem cedo. E essa mortalidade rápida pode sustentar uma população muito maior de predadores do que seria normal...
Levine estava visivelmente preocupado.
- Sabe - ele disse -, um dos comps me mordeu.
- Eu não me preocuparia - disse Sarah. - Pode causar uma leve encefalite, mas geralmente não passa de uma dor de cabeça. Vamos levá-lo a um médico em San
José.
Levine começou a suar. Enxugou a testa com a mão.
- Para falar a verdade, eu não estou me sentindo muito bem.
- Leva uma semana para se manifestar, Richard - Sarah disse. - Tenho certeza de que vai ficar bem.
Levine afundou no banco, muito infeliz.
- Mas o caso - ela disse - é que eu duvido que esta ilha possa nos dizer muita coisa sobre a extinção.
Malcolm olhou para os rochedos negros por algum tempo, depois começou a falar.
- Talvez seja a coisa mais certa, porque que a extinção sempre foi um grande mistério. Aconteceu cinco vezes neste planeta e nem sempre por causa de um asteróide.
Todo o mundo se interessa pela mortandade do Cretáceo que acabou com os dinossauros, mas houve mortandades iguais no fim do Jurássico e do Triássico também. Foram
graves, mas nenhuma se compara à extinção do Permiano, que matou noventa por cento da vida do planeta, no mar e na terra. Ninguém sabe o porquê dessa catástrofe.
Mas eu me pergunto se não seremos a causa da próxima.
- Por quê? - perguntou Kelly.
- Os seres humanos são extremamente destrutivos - disse Malcolm. - Às vezes eu penso que somos uma espécie de praga que vai acabar com tudo o que existe
na Terra. Nós destruímos tão bem que às vezes eu penso que essa é a nossa função. Talvez de milhões em milhões de anos apareça um animal que mata o resto do mundo,
esvazia o convés e deixa a evolução prosseguir para sua fase seguinte.
Kelly balançou a cabeça, saiu de perto de Malcolm e foi sentar ao lado de Thorne.
- Você está ouvindo isso? - Thorne disse. - Eu não levaria muito a sério. São apenas teorias. É próprio do ser humano criar teorias, mas a verdade é que
não passam de fantasias. E elas mudam. Quando a América era um país novo, todos acreditavam numa coisa chamada flogiston. Sabem o que é? Não? Bem, não importa porque
não era real. Acreditavam também que quatro humores controlavam o comportamento. E acreditavam que a Terra tivesse só alguns milhares de anos. Agora acreditamos
que a Terra tenha quatro bilhões de anos e acreditamos em fótons e elétrons e pensamos que o comportamento humano é controlado por coisas como o ego e a auto-estima.
Achamos essas crenças mais científicas e melhores.
- Não são?
Thorne deu de ombros.
- Não deixam de ser fantasias. Não são reais. Alguma vez você já viu a auto-estima? Pode me trazer uma numa bandeja? Que tal um fóton? Pode me trazer um?
.
Kelly balançou a cabeça.
- Não, mas...
E nunca vai poder porque essas coisas não existem, por mais que as pessoas as levem a sério. Daqui a cem anos as pessoas vão olhar para trás, para nós, e
achar graça. Vão dizer: "Sabe o que as pessoas acreditavam? Acreditavam em fótons e elétrons. Pode imaginar uma bobagem maior?" Vão dar boas risadas porque nessa
época terão fantasias mais novas e melhores. - Thorne balançou a cabeça. - Mas você sente o movimento do barco? Isso é o mar. Isso é real. Sente o cheiro do sal
no ar? Sente o sol na pele? Isso tudo é real. Vê nós todos aqui juntos? Isso é real. A vida é maravilhosa. É uma dádiva estar vivo, ver o sol e respirar o ar. E,
na verdade, não existe nada mais. Agora, olhe para aquela bússola e me diga onde fica o sul. Quero ir para Puerto Cortês. Está na hora de irmos todos para casa.


* * * FIM * * *

AGRADECIMENTOS


Este livro é todo ficção, mas para escrevê-lo tive de consultar trabalhos de pesquisadores em diversos campos. Devo muito ao trabalho e às sugestões de John
Alexander, Mark Boguski, Edwin Colbert, John Conway, Philip Currie, Peter Dodson, Nile Eldredge, Stephen Jay Gould, Donald Griffin, John Holland, John Horner, Fred
Hoyle, Stuart Kauffman, Christopher Langton, Erns Mayr, Mary Midgley, John Ostrom, Norman Packard, David Raup, Jeffrey Schank, Manfred Schroeder, George Gaylord
Simpson, Bruce Weber, John Wheeler e David Weishampel.
Resta apenas dizer que as opiniões expressas no livro são minhas, não deles, e lembrar ao leitor que, um século e meio depois de Darwin, quase todas as posições
sobre a evolução continuam a ser discutidas e ardorosamente debatidas.

Michael Crichton nasceu em Chicago em 1942 e se formou pela Harvard Medical School. Entre suas obras de sucesso incluem-se os romances O enigma de Andrômeda,
O parque dos dinossauros, Sol nascente e Revelação.
Entre os filmes que dirigiu estão Westworld, onde ninguém tem alma, a versão do seu romance O grande roubo do trem e Coma.

Nenhum comentário: